BLASTX nr result
ID: Rehmannia31_contig00025769
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025769 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072466.1| IAA-amino acid hydrolase ILR1-like 4 [Sesamu... 64 3e-09 >ref|XP_011072466.1| IAA-amino acid hydrolase ILR1-like 4 [Sesamum indicum] Length = 445 Score = 63.5 bits (153), Expect = 3e-09 Identities = 35/50 (70%), Positives = 41/50 (82%) Frame = -1 Query: 152 MSFCSKWAFLISIIFLFLCKPIFSDLILTPKELSNKIPINFLNFAKKAEV 3 MSF SK +FLI I+FL LCKP FSDL+LT K+L +IPINFLNFAK+ EV Sbjct: 1 MSF-SKVSFLIFILFLLLCKPTFSDLLLTSKDLP-EIPINFLNFAKQTEV 48