BLASTX nr result
ID: Rehmannia31_contig00025724
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025724 (985 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082067.1| uncharacterized protein LOC105164932 [Sesamu... 73 6e-13 ref|XP_022866921.1| uncharacterized protein LOC111386689 [Olea e... 70 5e-12 gb|PIN15931.1| hypothetical protein CDL12_11423 [Handroanthus im... 70 7e-12 ref|XP_018845631.1| PREDICTED: uncharacterized protein LOC109009... 70 1e-11 ref|XP_012855884.1| PREDICTED: uncharacterized protein LOC105975... 69 2e-11 ref|XP_006450186.1| uncharacterized protein LOC18054107 [Citrus ... 69 3e-11 gb|KZV31701.1| hypothetical protein F511_00505 [Dorcoceras hygro... 67 1e-10 ref|XP_021595576.1| uncharacterized protein LOC110602383 [Maniho... 67 1e-10 gb|POO03841.1| methionyl-tRNA synthetase [Trema orientalis] 66 3e-10 gb|PON73043.1| methionyl-tRNA synthetase [Parasponia andersonii] 66 3e-10 ref|XP_016560242.1| PREDICTED: uncharacterized protein LOC107859... 65 4e-10 ref|XP_009794092.1| PREDICTED: uncharacterized protein LOC104240... 65 5e-10 ref|XP_006363200.1| PREDICTED: uncharacterized protein LOC102603... 65 5e-10 ref|XP_015582677.1| PREDICTED: uncharacterized protein LOC828777... 65 7e-10 ref|XP_022750375.1| uncharacterized protein LOC111299450 [Durio ... 64 9e-10 ref|XP_010048384.1| PREDICTED: uncharacterized protein LOC104437... 64 1e-09 ref|XP_011459028.1| PREDICTED: uncharacterized protein LOC105349... 64 1e-09 ref|XP_007011606.1| PREDICTED: uncharacterized protein LOC185876... 64 1e-09 ref|XP_023736259.1| uncharacterized protein LOC111884168 [Lactuc... 64 1e-09 ref|XP_021608396.1| uncharacterized protein LOC110612057 [Maniho... 64 1e-09 >ref|XP_011082067.1| uncharacterized protein LOC105164932 [Sesamum indicum] Length = 66 Score = 73.2 bits (178), Expect = 6e-13 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 +DVQ+NWR CFVPLYFKTKRRFYCT+CSRRLVVQ Sbjct: 33 LDVQSNWRFCFVPLYFKTKRRFYCTVCSRRLVVQ 66 >ref|XP_022866921.1| uncharacterized protein LOC111386689 [Olea europaea var. sylvestris] Length = 66 Score = 70.5 bits (171), Expect = 5e-12 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++NWR CFVPLYFKTKR+FYC++CSRRLVVQ Sbjct: 33 MDVESNWRFCFVPLYFKTKRKFYCSVCSRRLVVQ 66 >gb|PIN15931.1| hypothetical protein CDL12_11423 [Handroanthus impetiginosus] Length = 66 Score = 70.1 bits (170), Expect = 7e-12 Identities = 30/34 (88%), Positives = 31/34 (91%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDVQ+ WR CFVPLYFKTKRR YCTICSRRLVVQ Sbjct: 33 MDVQSQWRFCFVPLYFKTKRRLYCTICSRRLVVQ 66 >ref|XP_018845631.1| PREDICTED: uncharacterized protein LOC109009566 [Juglans regia] Length = 66 Score = 69.7 bits (169), Expect = 1e-11 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDVQ+ WR CFVPLYFKTKR+FYCTIC+RRLV+Q Sbjct: 33 MDVQSQWRFCFVPLYFKTKRKFYCTICARRLVIQ 66 >ref|XP_012855884.1| PREDICTED: uncharacterized protein LOC105975255 [Erythranthe guttata] Length = 66 Score = 68.9 bits (167), Expect = 2e-11 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDVQ+ WRLCFVPLY+KTKRR YC+ICSRRLVVQ Sbjct: 33 MDVQSQWRLCFVPLYYKTKRRLYCSICSRRLVVQ 66 >ref|XP_006450186.1| uncharacterized protein LOC18054107 [Citrus clementina] ref|XP_006483555.1| PREDICTED: uncharacterized protein LOC102625548 [Citrus sinensis] gb|ESR63426.1| hypothetical protein CICLE_v10010727mg [Citrus clementina] gb|KDO67308.1| hypothetical protein CISIN_1g046214mg [Citrus sinensis] Length = 66 Score = 68.6 bits (166), Expect = 3e-11 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDVQ+ WR CF+PLYFKTKR+FYCT+C+RRLVVQ Sbjct: 33 MDVQSEWRFCFLPLYFKTKRKFYCTVCARRLVVQ 66 >gb|KZV31701.1| hypothetical protein F511_00505 [Dorcoceras hygrometricum] Length = 66 Score = 67.0 bits (162), Expect = 1e-10 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDVQ+ WR CFVPLYFKTKRR YC+ICSRRLV Q Sbjct: 33 MDVQSQWRFCFVPLYFKTKRRLYCSICSRRLVTQ 66 >ref|XP_021595576.1| uncharacterized protein LOC110602383 [Manihot esculenta] gb|OAY28841.1| hypothetical protein MANES_15G098500 [Manihot esculenta] Length = 67 Score = 67.0 bits (162), Expect = 1e-10 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLYFKTKRRFYC++CSRRLV+Q Sbjct: 33 MDVESKWRFCFLPLYFKTKRRFYCSVCSRRLVLQ 66 >gb|POO03841.1| methionyl-tRNA synthetase [Trema orientalis] Length = 67 Score = 65.9 bits (159), Expect = 3e-10 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLY+KT+R+FYCTICSRRLVVQ Sbjct: 33 MDVESQWRFCFLPLYWKTRRKFYCTICSRRLVVQ 66 >gb|PON73043.1| methionyl-tRNA synthetase [Parasponia andersonii] Length = 67 Score = 65.9 bits (159), Expect = 3e-10 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLY+KT+R+FYCTICSRRLVVQ Sbjct: 33 MDVESQWRFCFLPLYWKTRRKFYCTICSRRLVVQ 66 >ref|XP_016560242.1| PREDICTED: uncharacterized protein LOC107859675 [Capsicum annuum] gb|PHT90929.1| hypothetical protein T459_06042 [Capsicum annuum] Length = 66 Score = 65.5 bits (158), Expect = 4e-10 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 +DV++ WR CF+PLYFKTKRR+YCT+C+RRL+VQ Sbjct: 33 LDVESQWRFCFLPLYFKTKRRYYCTLCTRRLIVQ 66 >ref|XP_009794092.1| PREDICTED: uncharacterized protein LOC104240892 [Nicotiana sylvestris] ref|XP_016474175.1| PREDICTED: uncharacterized protein LOC107795980 [Nicotiana tabacum] ref|XP_016509542.1| PREDICTED: uncharacterized protein LOC107827005 [Nicotiana tabacum] ref|XP_018630208.1| PREDICTED: uncharacterized protein LOC104107808 [Nicotiana tomentosiformis] Length = 66 Score = 65.1 bits (157), Expect = 5e-10 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 +D+++ WR CFVPLYFKTKRR+YCT+C+RRL++Q Sbjct: 33 LDMESQWRFCFVPLYFKTKRRYYCTLCTRRLIIQ 66 >ref|XP_006363200.1| PREDICTED: uncharacterized protein LOC102603468 [Solanum tuberosum] Length = 66 Score = 65.1 bits (157), Expect = 5e-10 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 +D+++ WR CFVPLYFKTKRR+YCT+C+RRL++Q Sbjct: 33 LDMESQWRFCFVPLYFKTKRRYYCTLCTRRLIIQ 66 >ref|XP_015582677.1| PREDICTED: uncharacterized protein LOC8287777 [Ricinus communis] gb|EEF30261.1| conserved hypothetical protein [Ricinus communis] Length = 67 Score = 64.7 bits (156), Expect = 7e-10 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLYFKTK+RFYC++C+RRLV+Q Sbjct: 33 MDVESQWRFCFLPLYFKTKKRFYCSVCARRLVMQ 66 >ref|XP_022750375.1| uncharacterized protein LOC111299450 [Durio zibethinus] Length = 66 Score = 64.3 bits (155), Expect = 9e-10 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLYF+TKRR+YC++C+RRLVVQ Sbjct: 33 MDVESQWRFCFLPLYFRTKRRYYCSLCTRRLVVQ 66 >ref|XP_010048384.1| PREDICTED: uncharacterized protein LOC104437188 [Eucalyptus grandis] gb|KCW80638.1| hypothetical protein EUGRSUZ_C02015 [Eucalyptus grandis] Length = 67 Score = 64.3 bits (155), Expect = 1e-09 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLYF+TKR+FYC++C+RRLVVQ Sbjct: 33 MDVESQWRFCFLPLYFRTKRKFYCSLCARRLVVQ 66 >ref|XP_011459028.1| PREDICTED: uncharacterized protein LOC105349868 [Fragaria vesca subsp. vesca] Length = 66 Score = 63.9 bits (154), Expect = 1e-09 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV+T WR CF+PLY++TKR+FYC++C+RRLVVQ Sbjct: 33 MDVETQWRFCFLPLYWRTKRKFYCSLCARRLVVQ 66 >ref|XP_007011606.1| PREDICTED: uncharacterized protein LOC18587632 [Theobroma cacao] ref|XP_021276810.1| uncharacterized protein LOC110411112 [Herrania umbratica] gb|EOY29225.1| Methionyl-tRNA synthetase [Theobroma cacao] Length = 66 Score = 63.9 bits (154), Expect = 1e-09 Identities = 23/34 (67%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLYFKTKR++YC++C+RRLV+Q Sbjct: 33 MDVESQWRFCFLPLYFKTKRKYYCSLCARRLVIQ 66 >ref|XP_023736259.1| uncharacterized protein LOC111884168 [Lactuca sativa] gb|PLY71923.1| hypothetical protein LSAT_3X19520 [Lactuca sativa] Length = 67 Score = 63.9 bits (154), Expect = 1e-09 Identities = 22/34 (64%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MD+++ WRLCF+P Y+KTKR++YCT+CSRRL++Q Sbjct: 33 MDIESQWRLCFLPFYYKTKRKYYCTLCSRRLILQ 66 >ref|XP_021608396.1| uncharacterized protein LOC110612057 [Manihot esculenta] gb|OAY54495.1| hypothetical protein MANES_03G079400 [Manihot esculenta] Length = 67 Score = 63.9 bits (154), Expect = 1e-09 Identities = 24/34 (70%), Positives = 32/34 (94%) Frame = -3 Query: 983 MDVQTNWRLCFVPLYFKTKRRFYCTICSRRLVVQ 882 MDV++ WR CF+PLYFKTKRR++C++CSRRLV+Q Sbjct: 33 MDVESQWRFCFLPLYFKTKRRYHCSVCSRRLVLQ 66