BLASTX nr result
ID: Rehmannia31_contig00025611
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025611 (412 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM98176.1| putative GTPase-activating protein [Handroanthus ... 60 1e-07 >gb|PIM98176.1| putative GTPase-activating protein [Handroanthus impetiginosus] Length = 474 Score = 59.7 bits (143), Expect = 1e-07 Identities = 30/48 (62%), Positives = 33/48 (68%) Frame = -1 Query: 412 AVGANASKNGSIPSGTGKXXXXXXXXXXXXSGKEYDFSSLTQDFFSKH 269 AVGAN S+NG+IPSGTGK S KEYDFSSLTQ FF+KH Sbjct: 427 AVGANVSRNGTIPSGTGKQTASSVSSGSQQSAKEYDFSSLTQGFFTKH 474