BLASTX nr result
ID: Rehmannia31_contig00025610
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025610 (439 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085588.1| E3 ubiquitin-protein ligase At3g02290-like [... 86 7e-18 ref|XP_012840560.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 83 1e-16 gb|PIN06363.1| putative E3 ubiquitin ligase [Handroanthus impeti... 82 4e-16 gb|KZV46859.1| hypothetical protein F511_08620 [Dorcoceras hygro... 82 4e-16 gb|PIN17561.1| putative E3 ubiquitin ligase [Handroanthus impeti... 81 6e-16 ref|XP_006338331.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 81 8e-16 ref|XP_015063269.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 80 2e-15 ref|XP_004232134.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 80 2e-15 emb|CDP02344.1| unnamed protein product [Coffea canephora] 77 2e-14 ref|XP_011099045.1| E3 ubiquitin-protein ligase At3g02290 [Sesam... 77 2e-14 ref|XP_012851944.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 76 5e-14 ref|XP_022895852.1| E3 ubiquitin-protein ligase At3g02290-like i... 75 9e-14 ref|XP_019185730.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 75 9e-14 ref|XP_016561259.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 75 2e-13 ref|XP_023771440.1| E3 ubiquitin-protein ligase At3g02290-like [... 74 3e-13 ref|XP_019224684.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 74 5e-13 ref|XP_009778091.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 74 5e-13 ref|XP_009608003.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 74 5e-13 ref|XP_015063679.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 73 9e-13 ref|XP_004233394.1| PREDICTED: E3 ubiquitin-protein ligase At3g0... 73 9e-13 >ref|XP_011085588.1| E3 ubiquitin-protein ligase At3g02290-like [Sesamum indicum] Length = 227 Score = 86.3 bits (212), Expect = 7e-18 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGAACCCLRD+WE+FANPNSSIYRNCIC+HCFIQ+F+H Sbjct: 1 MGAACCCLRDDWEEFANPNSSIYRNCICIHCFIQNFVH 38 >ref|XP_012840560.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Erythranthe guttata] gb|EYU34585.1| hypothetical protein MIMGU_mgv1a013204mg [Erythranthe guttata] Length = 228 Score = 83.2 bits (204), Expect = 1e-16 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGAACCCLRD+ EDF+NPNSSIYRNCICLHCF+Q+FLH Sbjct: 1 MGAACCCLRDDLEDFSNPNSSIYRNCICLHCFVQAFLH 38 >gb|PIN06363.1| putative E3 ubiquitin ligase [Handroanthus impetiginosus] Length = 227 Score = 81.6 bits (200), Expect = 4e-16 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGAACCCLRD++ DFANPNSSIYRNCICLHCFIQ+ LH Sbjct: 1 MGAACCCLRDDYPDFANPNSSIYRNCICLHCFIQNLLH 38 >gb|KZV46859.1| hypothetical protein F511_08620 [Dorcoceras hygrometricum] Length = 230 Score = 81.6 bits (200), Expect = 4e-16 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFL 435 MGA CCC RD+WEDFANPNSS+YRNC+CLHCF+Q+FL Sbjct: 1 MGAVCCCWRDDWEDFANPNSSVYRNCVCLHCFVQNFL 37 >gb|PIN17561.1| putative E3 ubiquitin ligase [Handroanthus impetiginosus] Length = 227 Score = 81.3 bits (199), Expect = 6e-16 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGAACCCLR+E EDFANPNSSIYRNCICL CFIQ+FLH Sbjct: 1 MGAACCCLREECEDFANPNSSIYRNCICLRCFIQNFLH 38 >ref|XP_006338331.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum tuberosum] ref|XP_006338332.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum tuberosum] Length = 226 Score = 80.9 bits (198), Expect = 8e-16 Identities = 33/38 (86%), Positives = 35/38 (92%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSSIYRNCICL CF+Q+FLH Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCICLRCFVQNFLH 38 >ref|XP_015063269.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum pennellii] ref|XP_015063270.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum pennellii] ref|XP_015063271.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum pennellii] Length = 226 Score = 80.1 bits (196), Expect = 2e-15 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSSIYRNC+CL CF+Q+FLH Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCLCLRCFVQNFLH 38 >ref|XP_004232134.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Solanum lycopersicum] ref|XP_010316204.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Solanum lycopersicum] ref|XP_010316205.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Solanum lycopersicum] Length = 226 Score = 80.1 bits (196), Expect = 2e-15 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSSIYRNC+CL CF+Q+FLH Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCLCLRCFVQNFLH 38 >emb|CDP02344.1| unnamed protein product [Coffea canephora] Length = 227 Score = 77.4 bits (189), Expect = 2e-14 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MG+ CCCLRDE EDFANPNSS+YRNCICL CF+Q+F H Sbjct: 1 MGSVCCCLRDECEDFANPNSSVYRNCICLRCFLQNFFH 38 >ref|XP_011099045.1| E3 ubiquitin-protein ligase At3g02290 [Sesamum indicum] Length = 226 Score = 77.0 bits (188), Expect = 2e-14 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSF 432 MGAACCCLRD+ EDFANPNSSIYRNCICL CFIQ+F Sbjct: 1 MGAACCCLRDDCEDFANPNSSIYRNCICLRCFIQNF 36 >ref|XP_012851944.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Erythranthe guttata] gb|EYU44242.1| hypothetical protein MIMGU_mgv1a013043mg [Erythranthe guttata] Length = 232 Score = 76.3 bits (186), Expect = 5e-14 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGAACCCLRD+ EDFANPNSS+YRNC+ L CF+Q+FLH Sbjct: 1 MGAACCCLRDDCEDFANPNSSVYRNCVFLRCFVQNFLH 38 >ref|XP_022895852.1| E3 ubiquitin-protein ligase At3g02290-like isoform X1 [Olea europaea var. sylvestris] Length = 226 Score = 75.5 bits (184), Expect = 9e-14 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MG+ CCCLRDE E+F NPNSSIYRNCICL CF+Q+FLH Sbjct: 1 MGSFCCCLRDECEEFGNPNSSIYRNCICLQCFLQNFLH 38 >ref|XP_019185730.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Ipomoea nil] Length = 226 Score = 75.5 bits (184), Expect = 9e-14 Identities = 29/38 (76%), Positives = 36/38 (94%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCL+DE+++FA+PNSSIYRNCICL CF+Q+FLH Sbjct: 1 MGAVCCCLQDEFDNFASPNSSIYRNCICLRCFVQNFLH 38 >ref|XP_016561259.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Capsicum annuum] ref|XP_016561260.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Capsicum annuum] ref|XP_016561261.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290 [Capsicum annuum] Length = 226 Score = 74.7 bits (182), Expect = 2e-13 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSSIYRNCICL +Q+FLH Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCICLRSLVQNFLH 38 >ref|XP_023771440.1| E3 ubiquitin-protein ligase At3g02290-like [Lactuca sativa] ref|XP_023771441.1| E3 ubiquitin-protein ligase At3g02290-like [Lactuca sativa] Length = 235 Score = 74.3 bits (181), Expect = 3e-13 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MG+ CCCLRDE ED+ NPNSSIYRNCICL CF+Q+FL+ Sbjct: 1 MGSVCCCLRDECEDYVNPNSSIYRNCICLRCFLQNFLY 38 >ref|XP_019224684.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana attenuata] gb|OIT05841.1| e3 ubiquitin-protein ligase [Nicotiana attenuata] Length = 226 Score = 73.6 bits (179), Expect = 5e-13 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSS+YRNC+CL F+Q+F H Sbjct: 1 MGAVCCCLRDECEDFANPNSSMYRNCLCLRSFVQNFFH 38 >ref|XP_009778091.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana sylvestris] ref|XP_016506367.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana tabacum] Length = 226 Score = 73.6 bits (179), Expect = 5e-13 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSS+YRNC+CL F+Q+F H Sbjct: 1 MGAVCCCLRDECEDFANPNSSMYRNCLCLRSFVQNFFH 38 >ref|XP_009608003.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana tomentosiformis] ref|XP_016444805.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Nicotiana tabacum] Length = 226 Score = 73.6 bits (179), Expect = 5e-13 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSS+YRNC+CL F+Q+F H Sbjct: 1 MGAVCCCLRDECEDFANPNSSMYRNCLCLRSFVQNFFH 38 >ref|XP_015063679.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum pennellii] Length = 224 Score = 72.8 bits (177), Expect = 9e-13 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSSIYRNCIC IQ+FLH Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCICFPTLIQNFLH 38 >ref|XP_004233394.1| PREDICTED: E3 ubiquitin-protein ligase At3g02290-like [Solanum lycopersicum] Length = 224 Score = 72.8 bits (177), Expect = 9e-13 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +1 Query: 325 MGAACCCLRDEWEDFANPNSSIYRNCICLHCFIQSFLH 438 MGA CCCLRDE EDFANPNSSIYRNCIC IQ+FLH Sbjct: 1 MGAVCCCLRDECEDFANPNSSIYRNCICFPTLIQNFLH 38