BLASTX nr result
ID: Rehmannia31_contig00025518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025518 (510 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015871465.1| PREDICTED: helicase-like transcription facto... 112 3e-28 ref|XP_011096268.1| helicase-like transcription factor CHR28 iso... 119 4e-28 ref|XP_020553860.1| helicase-like transcription factor CHR28 iso... 119 4e-28 ref|XP_011096269.1| helicase-like transcription factor CHR28 iso... 119 4e-28 gb|EYU27947.1| hypothetical protein MIMGU_mgv1a001534mg [Erythra... 117 4e-27 ref|XP_012848853.1| PREDICTED: uncharacterized ATP-dependent hel... 117 4e-27 ref|XP_012848852.1| PREDICTED: uncharacterized protein LOC105968... 117 4e-27 gb|PIN19745.1| Helicase-like transcription factor HLTF/DNA helic... 115 1e-26 gb|KZV52280.1| hypothetical protein F511_39389 [Dorcoceras hygro... 115 1e-26 ref|XP_016501434.1| PREDICTED: helicase-like transcription facto... 114 4e-26 ref|XP_009782572.1| PREDICTED: uncharacterized protein LOC104231... 114 4e-26 ref|XP_019265602.1| PREDICTED: helicase-like transcription facto... 114 4e-26 ref|XP_009782567.1| PREDICTED: uncharacterized protein LOC104231... 114 4e-26 ref|XP_019265595.1| PREDICTED: helicase-like transcription facto... 114 4e-26 ref|XP_023917742.1| helicase-like transcription factor CHR28 iso... 114 5e-26 ref|XP_023917740.1| helicase-like transcription factor CHR28 iso... 114 5e-26 gb|POF03732.1| helicase-like transcription factor chr28 [Quercus... 114 5e-26 ref|XP_023917739.1| helicase-like transcription factor CHR28 iso... 114 5e-26 ref|XP_018809784.1| PREDICTED: helicase-like transcription facto... 113 8e-26 ref|XP_018809783.1| PREDICTED: helicase-like transcription facto... 113 8e-26 >ref|XP_015871465.1| PREDICTED: helicase-like transcription factor CHR28 [Ziziphus jujuba] Length = 159 Score = 112 bits (279), Expect = 3e-28 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPV+V RLTV DTVEDRILALQQ+KREMVASAFGED TGGRQTRLTVEDL Y Sbjct: 96 RAHRIGQTRPVTVLRLTVRDTVEDRILALQQKKREMVASAFGEDETGGRQTRLTVEDLKY 155 Query: 181 LF 186 LF Sbjct: 156 LF 157 >ref|XP_011096268.1| helicase-like transcription factor CHR28 isoform X4 [Sesamum indicum] Length = 1326 Score = 119 bits (299), Expect = 4e-28 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQRKREMVASAFGEDGTG RQTRLTVEDL Y Sbjct: 1262 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQRKREMVASAFGEDGTGSRQTRLTVEDLKY 1321 Query: 181 LFKV 192 LF+V Sbjct: 1322 LFRV 1325 >ref|XP_020553860.1| helicase-like transcription factor CHR28 isoform X2 [Sesamum indicum] Length = 1356 Score = 119 bits (299), Expect = 4e-28 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQRKREMVASAFGEDGTG RQTRLTVEDL Y Sbjct: 1292 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQRKREMVASAFGEDGTGSRQTRLTVEDLKY 1351 Query: 181 LFKV 192 LF+V Sbjct: 1352 LFRV 1355 >ref|XP_011096269.1| helicase-like transcription factor CHR28 isoform X1 [Sesamum indicum] Length = 1362 Score = 119 bits (299), Expect = 4e-28 Identities = 60/64 (93%), Positives = 61/64 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQRKREMVASAFGEDGTG RQTRLTVEDL Y Sbjct: 1298 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQRKREMVASAFGEDGTGSRQTRLTVEDLKY 1357 Query: 181 LFKV 192 LF+V Sbjct: 1358 LFRV 1361 >gb|EYU27947.1| hypothetical protein MIMGU_mgv1a001534mg [Erythranthe guttata] Length = 800 Score = 117 bits (292), Expect = 4e-27 Identities = 58/63 (92%), Positives = 60/63 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQ+KREMVASAFGEDGTGG QTRLTVEDL Y Sbjct: 736 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQKKREMVASAFGEDGTGGTQTRLTVEDLKY 795 Query: 181 LFK 189 LF+ Sbjct: 796 LFR 798 >ref|XP_012848853.1| PREDICTED: uncharacterized ATP-dependent helicase C23E6.02-like isoform X2 [Erythranthe guttata] Length = 1277 Score = 117 bits (292), Expect = 4e-27 Identities = 58/63 (92%), Positives = 60/63 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQ+KREMVASAFGEDGTGG QTRLTVEDL Y Sbjct: 1213 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQKKREMVASAFGEDGTGGTQTRLTVEDLKY 1272 Query: 181 LFK 189 LF+ Sbjct: 1273 LFR 1275 >ref|XP_012848852.1| PREDICTED: uncharacterized protein LOC105968738 isoform X1 [Erythranthe guttata] Length = 1301 Score = 117 bits (292), Expect = 4e-27 Identities = 58/63 (92%), Positives = 60/63 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQ+KREMVASAFGEDGTGG QTRLTVEDL Y Sbjct: 1237 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQKKREMVASAFGEDGTGGTQTRLTVEDLKY 1296 Query: 181 LFK 189 LF+ Sbjct: 1297 LFR 1299 >gb|PIN19745.1| Helicase-like transcription factor HLTF/DNA helicase RAD5, DEAD-box superfamily [Handroanthus impetiginosus] Length = 907 Score = 115 bits (288), Expect = 1e-26 Identities = 57/63 (90%), Positives = 60/63 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQ+KREMVASAFGEDG G RQ+RLTVEDLNY Sbjct: 843 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQKKREMVASAFGEDGKGSRQSRLTVEDLNY 902 Query: 181 LFK 189 LF+ Sbjct: 903 LFR 905 >gb|KZV52280.1| hypothetical protein F511_39389 [Dorcoceras hygrometricum] Length = 1297 Score = 115 bits (288), Expect = 1e-26 Identities = 58/62 (93%), Positives = 59/62 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSVFRLTV DTVEDRILALQQRKREMV+SAFGED TGGRQTRLTVEDL Y Sbjct: 1234 RAHRIGQTRPVSVFRLTVKDTVEDRILALQQRKREMVSSAFGEDETGGRQTRLTVEDLKY 1293 Query: 181 LF 186 LF Sbjct: 1294 LF 1295 >ref|XP_016501434.1| PREDICTED: helicase-like transcription factor CHR28, partial [Nicotiana tabacum] Length = 834 Score = 114 bits (284), Expect = 4e-26 Identities = 57/64 (89%), Positives = 59/64 (92%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSV RLTV DTVEDRILALQQ+KREMVASAFGED TG RQTRLTVEDL Y Sbjct: 771 RAHRIGQTRPVSVLRLTVKDTVEDRILALQQKKREMVASAFGEDETGSRQTRLTVEDLEY 830 Query: 181 LFKV 192 LFK+ Sbjct: 831 LFKI 834 >ref|XP_009782572.1| PREDICTED: uncharacterized protein LOC104231294 isoform X2 [Nicotiana sylvestris] Length = 1307 Score = 114 bits (284), Expect = 4e-26 Identities = 57/64 (89%), Positives = 59/64 (92%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSV RLTV DTVEDRILALQQ+KREMVASAFGED TG RQTRLTVEDL Y Sbjct: 1244 RAHRIGQTRPVSVLRLTVKDTVEDRILALQQKKREMVASAFGEDETGSRQTRLTVEDLEY 1303 Query: 181 LFKV 192 LFK+ Sbjct: 1304 LFKI 1307 >ref|XP_019265602.1| PREDICTED: helicase-like transcription factor CHR28 isoform X2 [Nicotiana attenuata] Length = 1308 Score = 114 bits (284), Expect = 4e-26 Identities = 57/64 (89%), Positives = 59/64 (92%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSV RLTV DTVEDRILALQQ+KREMVASAFGED TG RQTRLTVEDL Y Sbjct: 1245 RAHRIGQTRPVSVLRLTVKDTVEDRILALQQKKREMVASAFGEDETGSRQTRLTVEDLEY 1304 Query: 181 LFKV 192 LFK+ Sbjct: 1305 LFKI 1308 >ref|XP_009782567.1| PREDICTED: uncharacterized protein LOC104231294 isoform X1 [Nicotiana sylvestris] Length = 1308 Score = 114 bits (284), Expect = 4e-26 Identities = 57/64 (89%), Positives = 59/64 (92%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSV RLTV DTVEDRILALQQ+KREMVASAFGED TG RQTRLTVEDL Y Sbjct: 1245 RAHRIGQTRPVSVLRLTVKDTVEDRILALQQKKREMVASAFGEDETGSRQTRLTVEDLEY 1304 Query: 181 LFKV 192 LFK+ Sbjct: 1305 LFKI 1308 >ref|XP_019265595.1| PREDICTED: helicase-like transcription factor CHR28 isoform X1 [Nicotiana attenuata] gb|OIT05439.1| helicase-like transcription factor chr28 [Nicotiana attenuata] Length = 1309 Score = 114 bits (284), Expect = 4e-26 Identities = 57/64 (89%), Positives = 59/64 (92%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPVSV RLTV DTVEDRILALQQ+KREMVASAFGED TG RQTRLTVEDL Y Sbjct: 1246 RAHRIGQTRPVSVLRLTVKDTVEDRILALQQKKREMVASAFGEDETGSRQTRLTVEDLEY 1305 Query: 181 LFKV 192 LFK+ Sbjct: 1306 LFKI 1309 >ref|XP_023917742.1| helicase-like transcription factor CHR28 isoform X3 [Quercus suber] Length = 1326 Score = 114 bits (284), Expect = 5e-26 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPV+V RLTV DTVEDRILALQQ+KREMVA+AFGEDGTGGRQTRLTVEDL Y Sbjct: 1263 RAHRIGQTRPVTVLRLTVRDTVEDRILALQQKKREMVAAAFGEDGTGGRQTRLTVEDLKY 1322 Query: 181 LF 186 LF Sbjct: 1323 LF 1324 >ref|XP_023917740.1| helicase-like transcription factor CHR28 isoform X2 [Quercus suber] ref|XP_023917741.1| helicase-like transcription factor CHR28 isoform X2 [Quercus suber] Length = 1346 Score = 114 bits (284), Expect = 5e-26 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPV+V RLTV DTVEDRILALQQ+KREMVA+AFGEDGTGGRQTRLTVEDL Y Sbjct: 1283 RAHRIGQTRPVTVLRLTVRDTVEDRILALQQKKREMVAAAFGEDGTGGRQTRLTVEDLKY 1342 Query: 181 LF 186 LF Sbjct: 1343 LF 1344 >gb|POF03732.1| helicase-like transcription factor chr28 [Quercus suber] Length = 1402 Score = 114 bits (284), Expect = 5e-26 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPV+V RLTV DTVEDRILALQQ+KREMVA+AFGEDGTGGRQTRLTVEDL Y Sbjct: 1339 RAHRIGQTRPVTVLRLTVRDTVEDRILALQQKKREMVAAAFGEDGTGGRQTRLTVEDLKY 1398 Query: 181 LF 186 LF Sbjct: 1399 LF 1400 >ref|XP_023917739.1| helicase-like transcription factor CHR28 isoform X1 [Quercus suber] Length = 1432 Score = 114 bits (284), Expect = 5e-26 Identities = 56/62 (90%), Positives = 59/62 (95%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPV+V RLTV DTVEDRILALQQ+KREMVA+AFGEDGTGGRQTRLTVEDL Y Sbjct: 1369 RAHRIGQTRPVTVLRLTVRDTVEDRILALQQKKREMVAAAFGEDGTGGRQTRLTVEDLKY 1428 Query: 181 LF 186 LF Sbjct: 1429 LF 1430 >ref|XP_018809784.1| PREDICTED: helicase-like transcription factor CHR28 isoform X2 [Juglans regia] Length = 1145 Score = 113 bits (282), Expect = 8e-26 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPV V RLTV DTVEDRILALQQ+KR+MVASAFGEDGTGGRQTRLTVEDL Y Sbjct: 1082 RAHRIGQTRPVRVLRLTVRDTVEDRILALQQKKRQMVASAFGEDGTGGRQTRLTVEDLKY 1141 Query: 181 LF 186 LF Sbjct: 1142 LF 1143 >ref|XP_018809783.1| PREDICTED: helicase-like transcription factor CHR28 isoform X1 [Juglans regia] Length = 1260 Score = 113 bits (282), Expect = 8e-26 Identities = 56/62 (90%), Positives = 58/62 (93%) Frame = +1 Query: 1 RAHRIGQTRPVSVFRLTVNDTVEDRILALQQRKREMVASAFGEDGTGGRQTRLTVEDLNY 180 RAHRIGQTRPV V RLTV DTVEDRILALQQ+KR+MVASAFGEDGTGGRQTRLTVEDL Y Sbjct: 1197 RAHRIGQTRPVRVLRLTVRDTVEDRILALQQKKRQMVASAFGEDGTGGRQTRLTVEDLKY 1256 Query: 181 LF 186 LF Sbjct: 1257 LF 1258