BLASTX nr result
ID: Rehmannia31_contig00025386
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025386 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN23106.1| Integral membrane protein [Handroanthus impetigin... 77 4e-14 ref|XP_011080031.1| autophagy-related protein 9 [Sesamum indicum... 76 1e-13 ref|XP_012831350.1| PREDICTED: autophagy-related protein 9 [Eryt... 68 7e-11 ref|XP_022860399.1| autophagy-related protein 9-like isoform X2 ... 61 2e-08 ref|XP_022860397.1| autophagy-related protein 9-like isoform X1 ... 61 2e-08 >gb|PIN23106.1| Integral membrane protein [Handroanthus impetiginosus] Length = 859 Score = 77.4 bits (189), Expect = 4e-14 Identities = 35/53 (66%), Positives = 43/53 (81%) Frame = +2 Query: 2 VEEQRLDLGKSRGLSRTFYMDDLDGGDFNLPFVDIYHSPIQSVDGDADPESLV 160 VEE +L+ SRGLSRTFYMDD+DGGDFNLPF DIY SP +S++ D DP ++V Sbjct: 807 VEEHQLERRNSRGLSRTFYMDDIDGGDFNLPFDDIYRSPSESMNEDTDPANIV 859 >ref|XP_011080031.1| autophagy-related protein 9 [Sesamum indicum] ref|XP_020550201.1| autophagy-related protein 9 [Sesamum indicum] Length = 864 Score = 76.3 bits (186), Expect = 1e-13 Identities = 36/53 (67%), Positives = 42/53 (79%) Frame = +2 Query: 2 VEEQRLDLGKSRGLSRTFYMDDLDGGDFNLPFVDIYHSPIQSVDGDADPESLV 160 VEE +LD SRGLSRTFYMDDLDGGDF+LPF D+Y SP + V +ADP +LV Sbjct: 812 VEEPQLDFRNSRGLSRTFYMDDLDGGDFSLPFGDVYRSPSEGVAENADPGNLV 864 >ref|XP_012831350.1| PREDICTED: autophagy-related protein 9 [Erythranthe guttata] gb|EYU46469.1| hypothetical protein MIMGU_mgv1a001180mg [Erythranthe guttata] Length = 871 Score = 68.2 bits (165), Expect = 7e-11 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +2 Query: 5 EEQRLDLGKSRGLSRTFYMDDLDGGDFNLPFVDIY--HSPIQSVDGDADPESLV 160 EE++LDL SRGLSRTFYMDD+DGGDFNLPFVDIY H + + DP ++V Sbjct: 818 EEEQLDLRNSRGLSRTFYMDDVDGGDFNLPFVDIYGAHEENANEGENDDPLNIV 871 >ref|XP_022860399.1| autophagy-related protein 9-like isoform X2 [Olea europaea var. sylvestris] Length = 856 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +2 Query: 8 EQRLDLGKSRGLSRTFYMDDLDGGDFNLPFVDIYHSPIQSVDGDADPESLV 160 EQ LD SR LSRTFYMD+L+ G+FNL F DIY P +S DADP ++V Sbjct: 806 EQLLDWRNSRRLSRTFYMDNLEAGEFNLAFDDIYRRPSESPSEDADPANVV 856 >ref|XP_022860397.1| autophagy-related protein 9-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022860398.1| autophagy-related protein 9-like isoform X1 [Olea europaea var. sylvestris] Length = 868 Score = 61.2 bits (147), Expect = 2e-08 Identities = 30/51 (58%), Positives = 36/51 (70%) Frame = +2 Query: 8 EQRLDLGKSRGLSRTFYMDDLDGGDFNLPFVDIYHSPIQSVDGDADPESLV 160 EQ LD SR LSRTFYMD+L+ G+FNL F DIY P +S DADP ++V Sbjct: 818 EQLLDWRNSRRLSRTFYMDNLEAGEFNLAFDDIYRRPSESPSEDADPANVV 868