BLASTX nr result
ID: Rehmannia31_contig00025326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025326 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_588284.1| hypothetical protein ZeamMp020 (mitochondrion) ... 67 6e-20 gb|PPS05906.1| hypothetical protein GOBAR_AA14739 [Gossypium bar... 60 1e-07 >ref|YP_588284.1| hypothetical protein ZeamMp020 (mitochondrion) [Zea mays subsp. mays] ref|YP_588308.1| hypothetical protein ZeamMp046 (mitochondrion) [Zea mays subsp. mays] gb|AAR91182.1| hypothetical protein (mitochondrion) [Zea mays] gb|AAR91183.1| hypothetical protein (mitochondrion) [Zea mays] Length = 99 Score = 67.4 bits (163), Expect(2) = 6e-20 Identities = 37/74 (50%), Positives = 48/74 (64%), Gaps = 7/74 (9%) Frame = -2 Query: 296 EEIKHGNKKK-KFLFDYFDRGGWRKWTKQTRISHRR------NRGKESY*KLS*PTFVEP 138 ++IKHGNKK K LF +F RGGW KW KQT I + +R ++++ + + FV P Sbjct: 2 DKIKHGNKKHLKCLFYHFYRGGWIKWAKQTHIFQSKRWVPFSSRQRKNHLENAPNPFVGP 61 Query: 137 CIVSDPNLPGARLP 96 CIVSDPNLPGA P Sbjct: 62 CIVSDPNLPGASPP 75 Score = 57.8 bits (138), Expect(2) = 6e-20 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = -1 Query: 108 SAPPIEASEVGEPYDGQLSPAVRRGLSC 25 ++PP+EASEVGEPYDGQLSPAVRRGLSC Sbjct: 72 ASPPLEASEVGEPYDGQLSPAVRRGLSC 99 >gb|PPS05906.1| hypothetical protein GOBAR_AA14739 [Gossypium barbadense] Length = 346 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 29 LSPLRTAGDSCPSYGSPTSLASMGGALRA 115 LSPLRTAGDSCPSYGSPTSLASMGG+LRA Sbjct: 229 LSPLRTAGDSCPSYGSPTSLASMGGSLRA 257