BLASTX nr result
ID: Rehmannia31_contig00025244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025244 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020552569.1| glucomannan 4-beta-mannosyltransferase 1 iso... 80 1e-14 ref|XP_020552568.1| glucomannan 4-beta-mannosyltransferase 2 iso... 80 1e-14 ref|XP_011088832.1| probable mannan synthase 11 isoform X1 [Sesa... 80 1e-14 ref|XP_012837984.1| PREDICTED: probable mannan synthase 11 [Eryt... 77 1e-13 gb|EYU36983.1| hypothetical protein MIMGU_mgv1a004073mg [Erythra... 73 2e-12 emb|CDP06989.1| unnamed protein product [Coffea canephora] 67 5e-10 gb|ACF33171.1| mannan synthase [Coffea canephora] 67 5e-10 ref|XP_022887795.1| glucomannan 4-beta-mannosyltransferase 2-lik... 65 1e-09 ref|XP_011089999.1| glucomannan 4-beta-mannosyltransferase 2 [Se... 65 1e-09 gb|PIN10894.1| Glucomannan 4-beta-mannosyltransferase [Handroant... 65 2e-09 gb|KZV42622.1| glucomannan 4-beta-mannosyltransferase 2-like [Do... 64 3e-09 ref|XP_019176173.1| PREDICTED: glucomannan 4-beta-mannosyltransf... 64 4e-09 ref|XP_019161997.1| PREDICTED: glucomannan 4-beta-mannosyltransf... 64 4e-09 ref|XP_019267056.1| PREDICTED: glucomannan 4-beta-mannosyltransf... 64 5e-09 ref|XP_022898505.1| glucomannan 4-beta-mannosyltransferase 2-lik... 63 7e-09 gb|PHU15792.1| Glucomannan 4-beta-mannosyltransferase 2 [Capsicu... 63 7e-09 gb|PHT30086.1| Glucomannan 4-beta-mannosyltransferase 2 [Capsicu... 63 7e-09 ref|XP_016577909.1| PREDICTED: glucomannan 4-beta-mannosyltransf... 63 7e-09 ref|XP_015077524.1| PREDICTED: glucomannan 4-beta-mannosyltransf... 63 7e-09 ref|XP_006347222.1| PREDICTED: glucomannan 4-beta-mannosyltransf... 63 7e-09 >ref|XP_020552569.1| glucomannan 4-beta-mannosyltransferase 1 isoform X3 [Sesamum indicum] ref|XP_020552570.1| glucomannan 4-beta-mannosyltransferase 1 isoform X3 [Sesamum indicum] Length = 406 Score = 79.7 bits (195), Expect = 1e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LFACGCYGIFY D YYIYLFPQAIFF IAGFG FGTI+P+ Sbjct: 365 LFACGCYGIFYGPDHYYIYLFPQAIFFAIAGFGLFGTILPS 405 >ref|XP_020552568.1| glucomannan 4-beta-mannosyltransferase 2 isoform X2 [Sesamum indicum] Length = 454 Score = 79.7 bits (195), Expect = 1e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LFACGCYGIFY D YYIYLFPQAIFF IAGFG FGTI+P+ Sbjct: 413 LFACGCYGIFYGPDHYYIYLFPQAIFFAIAGFGLFGTILPS 453 >ref|XP_011088832.1| probable mannan synthase 11 isoform X1 [Sesamum indicum] Length = 565 Score = 79.7 bits (195), Expect = 1e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LFACGCYGIFY D YYIYLFPQAIFF IAGFG FGTI+P+ Sbjct: 524 LFACGCYGIFYGPDHYYIYLFPQAIFFAIAGFGLFGTILPS 564 >ref|XP_012837984.1| PREDICTED: probable mannan synthase 11 [Erythranthe guttata] Length = 569 Score = 76.6 bits (187), Expect = 1e-13 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTSLT 280 L+ACG YG+FY +D+YYIYLFPQAIFFT+AGFGY+GT++ ++ Sbjct: 523 LYACGLYGVFYGDDKYYIYLFPQAIFFTVAGFGYYGTMIAAPIS 566 >gb|EYU36983.1| hypothetical protein MIMGU_mgv1a004073mg [Erythranthe guttata] Length = 545 Score = 73.2 bits (178), Expect = 2e-12 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTS 286 L+ACG YG+FY +D+YYIYLFPQAIFFT+AGFGY+ T V S Sbjct: 504 LYACGLYGVFYGDDKYYIYLFPQAIFFTVAGFGYYATNVRKS 545 >emb|CDP06989.1| unnamed protein product [Coffea canephora] Length = 537 Score = 66.6 bits (161), Expect = 5e-10 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTS 286 LF CGCY Y ++ Y+IYLF Q I FTIAGFGY GTIVPTS Sbjct: 496 LFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPTS 537 >gb|ACF33171.1| mannan synthase [Coffea canephora] Length = 537 Score = 66.6 bits (161), Expect = 5e-10 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTS 286 LF CGCY Y ++ Y+IYLF Q I FTIAGFGY GTIVPTS Sbjct: 496 LFFCGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPTS 537 >ref|XP_022887795.1| glucomannan 4-beta-mannosyltransferase 2-like [Olea europaea var. sylvestris] Length = 298 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTS 286 LF CGCY Y ++ Y+IYLF Q I FTIAGFGY GTIVP+S Sbjct: 257 LFICGCYDFLYGKNNYFIYLFLQVITFTIAGFGYVGTIVPSS 298 >ref|XP_011089999.1| glucomannan 4-beta-mannosyltransferase 2 [Sesamum indicum] Length = 536 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTS 286 LF CGCY Y ++ Y+IYLF Q I FTIAGFGY GTIVP+S Sbjct: 495 LFICGCYDFLYGKNNYFIYLFLQVITFTIAGFGYIGTIVPSS 536 >gb|PIN10894.1| Glucomannan 4-beta-mannosyltransferase [Handroanthus impetiginosus] Length = 535 Score = 65.1 bits (157), Expect = 2e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTS 286 LF CGCY Y ++ Y+IYLF Q I FTIAGFGY GTIVP+S Sbjct: 494 LFICGCYDFLYGKNNYFIYLFLQVITFTIAGFGYVGTIVPSS 535 >gb|KZV42622.1| glucomannan 4-beta-mannosyltransferase 2-like [Dorcoceras hygrometricum] Length = 537 Score = 64.3 bits (155), Expect = 3e-09 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPTS 286 LF CGCY Y ++ Y+IYLF Q I FTIAGFGY GTIVP+S Sbjct: 496 LFICGCYDFLYGKNCYFIYLFLQVITFTIAGFGYIGTIVPSS 537 >ref|XP_019176173.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Ipomoea nil] Length = 534 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY Y +++Y+IYLF Q I FTIAGFGY GTIVP+ Sbjct: 494 LFFCGCYDFMYGKNQYFIYLFLQVITFTIAGFGYIGTIVPS 534 >ref|XP_019161997.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Ipomoea nil] Length = 536 Score = 63.9 bits (154), Expect = 4e-09 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY Y +++Y+IYLF Q I FTIAGFGY GTIVP+ Sbjct: 496 LFFCGCYDFLYGKNQYFIYLFLQVITFTIAGFGYIGTIVPS 536 >ref|XP_019267056.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Nicotiana attenuata] gb|OIT34633.1| glucomannan 4-beta-mannosyltransferase 2 [Nicotiana attenuata] Length = 533 Score = 63.5 bits (153), Expect = 5e-09 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY + Y +++Y++Y+F Q I FTIAGFGY GTIVP+ Sbjct: 493 LFFCGCYDVLYGKNQYFLYIFLQVITFTIAGFGYIGTIVPS 533 >ref|XP_022898505.1| glucomannan 4-beta-mannosyltransferase 2-like [Olea europaea var. sylvestris] Length = 296 Score = 62.8 bits (151), Expect = 7e-09 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY Y ++ Y+IYLF Q I FTIAGFGY GTIVP+ Sbjct: 256 LFICGCYDFLYGKNCYFIYLFLQVITFTIAGFGYLGTIVPS 296 >gb|PHU15792.1| Glucomannan 4-beta-mannosyltransferase 2 [Capsicum chinense] Length = 533 Score = 63.2 bits (152), Expect = 7e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY + Y + +Y++Y+F Q I FTIAGFGY GTIVP+ Sbjct: 493 LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS 533 >gb|PHT30086.1| Glucomannan 4-beta-mannosyltransferase 2 [Capsicum baccatum] Length = 533 Score = 63.2 bits (152), Expect = 7e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY + Y + +Y++Y+F Q I FTIAGFGY GTIVP+ Sbjct: 493 LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS 533 >ref|XP_016577909.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Capsicum annuum] gb|PHT80034.1| Glucomannan 4-beta-mannosyltransferase 2 [Capsicum annuum] Length = 533 Score = 63.2 bits (152), Expect = 7e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY + Y + +Y++Y+F Q I FTIAGFGY GTIVP+ Sbjct: 493 LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS 533 >ref|XP_015077524.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum pennellii] Length = 533 Score = 63.2 bits (152), Expect = 7e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY + Y + +Y++Y+F Q I FTIAGFGY GTIVP+ Sbjct: 493 LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS 533 >ref|XP_006347222.1| PREDICTED: glucomannan 4-beta-mannosyltransferase 2-like [Solanum tuberosum] Length = 533 Score = 63.2 bits (152), Expect = 7e-09 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = -1 Query: 411 LFACGCYGIFYSEDRYYIYLFPQAIFFTIAGFGYFGTIVPT 289 LF CGCY + Y + +Y++Y+F Q I FTIAGFGY GTIVP+ Sbjct: 493 LFFCGCYDVLYGKSQYFLYIFLQVITFTIAGFGYIGTIVPS 533