BLASTX nr result
ID: Rehmannia31_contig00025144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025144 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV18516.1| BTB/POZ and MATH domain-containing protein 2-like... 77 2e-13 gb|PIM98264.1| Speckle-type POZ protein SPOP [Handroanthus impet... 77 2e-13 ref|XP_011082543.1| BTB/POZ and MATH domain-containing protein 2... 77 2e-13 ref|XP_012832653.1| PREDICTED: BTB/POZ and MATH domain-containin... 77 2e-13 ref|XP_023738374.1| BTB/POZ and MATH domain-containing protein 2... 76 2e-13 gb|PNT14416.1| hypothetical protein POPTR_010G029500v3 [Populus ... 75 3e-13 ref|XP_006380052.1| hypothetical protein POPTR_0008s20510g [Popu... 75 3e-13 gb|PNT14418.1| hypothetical protein POPTR_010G029500v3 [Populus ... 75 4e-13 gb|PNT14420.1| hypothetical protein POPTR_010G029500v3 [Populus ... 75 4e-13 gb|PIA44776.1| hypothetical protein AQUCO_01700398v1 [Aquilegia ... 75 4e-13 ref|XP_022010636.1| BTB/POZ and MATH domain-containing protein 2... 75 4e-13 ref|XP_012092297.1| BTB/POZ and MATH domain-containing protein 2... 75 4e-13 gb|PIN18183.1| Speckle-type POZ protein SPOP [Handroanthus impet... 75 4e-13 ref|XP_006380053.1| hypothetical protein POPTR_0008s20510g [Popu... 75 5e-13 ref|XP_022758162.1| BTB/POZ and MATH domain-containing protein 2... 75 5e-13 ref|XP_011079801.1| BTB/POZ and MATH domain-containing protein 2... 75 5e-13 gb|PNT14417.1| hypothetical protein POPTR_010G029500v3 [Populus ... 75 6e-13 gb|KJB25906.1| hypothetical protein B456_004G215300 [Gossypium r... 74 7e-13 ref|XP_010090357.1| BTB/POZ and MATH domain-containing protein 2... 75 7e-13 ref|XP_011009015.1| PREDICTED: BTB/POZ and MATH domain-containin... 75 7e-13 >gb|KZV18516.1| BTB/POZ and MATH domain-containing protein 2-like [Dorcoceras hygrometricum] Length = 407 Score = 76.6 bits (187), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 107 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 140 >gb|PIM98264.1| Speckle-type POZ protein SPOP [Handroanthus impetiginosus] Length = 409 Score = 76.6 bits (187), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 110 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 143 >ref|XP_011082543.1| BTB/POZ and MATH domain-containing protein 2 [Sesamum indicum] Length = 410 Score = 76.6 bits (187), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 110 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 143 >ref|XP_012832653.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Erythranthe guttata] gb|EYU46623.1| hypothetical protein MIMGU_mgv1a007354mg [Erythranthe guttata] Length = 410 Score = 76.6 bits (187), Expect = 2e-13 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 110 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 143 >ref|XP_023738374.1| BTB/POZ and MATH domain-containing protein 2-like [Lactuca sativa] gb|PLY70215.1| hypothetical protein LSAT_9X4501 [Lactuca sativa] Length = 405 Score = 76.3 bits (186), Expect = 2e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHK+HSHFGRALESGPYTLKYRGSMW Sbjct: 105 LLDQSGRERHKIHSHFGRALESGPYTLKYRGSMW 138 >gb|PNT14416.1| hypothetical protein POPTR_010G029500v3 [Populus trichocarpa] Length = 273 Score = 74.7 bits (182), Expect = 3e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 L+DQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 111 LMDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 144 >ref|XP_006380052.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa] gb|PNT25766.1| hypothetical protein POPTR_008G200700v3 [Populus trichocarpa] Length = 285 Score = 74.7 bits (182), Expect = 3e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 L+DQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 110 LMDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 143 >gb|PNT14418.1| hypothetical protein POPTR_010G029500v3 [Populus trichocarpa] gb|PNT14419.1| hypothetical protein POPTR_010G029500v3 [Populus trichocarpa] Length = 288 Score = 74.7 bits (182), Expect = 4e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 L+DQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 111 LMDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 144 >gb|PNT14420.1| hypothetical protein POPTR_010G029500v3 [Populus trichocarpa] Length = 290 Score = 74.7 bits (182), Expect = 4e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 L+DQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 111 LMDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 144 >gb|PIA44776.1| hypothetical protein AQUCO_01700398v1 [Aquilegia coerulea] Length = 401 Score = 75.5 bits (184), Expect = 4e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 101 LLDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 134 >ref|XP_022010636.1| BTB/POZ and MATH domain-containing protein 2-like [Helianthus annuus] ref|XP_022010637.1| BTB/POZ and MATH domain-containing protein 2-like [Helianthus annuus] gb|OTF93921.1| putative TRAF-like, SKP1/BTB/POZ domain protein [Helianthus annuus] Length = 406 Score = 75.5 bits (184), Expect = 4e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGRALESGPYTLKY+GSMW Sbjct: 106 LLDQSGRERHKVHSHFGRALESGPYTLKYKGSMW 139 >ref|XP_012092297.1| BTB/POZ and MATH domain-containing protein 2 [Jatropha curcas] gb|KDP21503.1| hypothetical protein JCGZ_21974 [Jatropha curcas] Length = 407 Score = 75.5 bits (184), Expect = 4e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 107 LLDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 140 >gb|PIN18183.1| Speckle-type POZ protein SPOP [Handroanthus impetiginosus] Length = 410 Score = 75.5 bits (184), Expect = 4e-13 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 110 LLDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 143 >ref|XP_006380053.1| hypothetical protein POPTR_0008s20510g [Populus trichocarpa] gb|PNT25768.1| hypothetical protein POPTR_008G200700v3 [Populus trichocarpa] Length = 325 Score = 74.7 bits (182), Expect = 5e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 L+DQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 110 LMDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 143 >ref|XP_022758162.1| BTB/POZ and MATH domain-containing protein 2-like [Durio zibethinus] Length = 407 Score = 75.1 bits (183), Expect = 5e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGR LESGPYTLKYRGSMW Sbjct: 106 LLDQSGRERHKVHSHFGRTLESGPYTLKYRGSMW 139 >ref|XP_011079801.1| BTB/POZ and MATH domain-containing protein 2-like [Sesamum indicum] Length = 410 Score = 75.1 bits (183), Expect = 5e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGR LESGPYTLKYRGSMW Sbjct: 110 LLDQSGRERHKVHSHFGRTLESGPYTLKYRGSMW 143 >gb|PNT14417.1| hypothetical protein POPTR_010G029500v3 [Populus trichocarpa] Length = 367 Score = 74.7 bits (182), Expect = 6e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 L+DQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 111 LMDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 144 >gb|KJB25906.1| hypothetical protein B456_004G215300 [Gossypium raimondii] Length = 284 Score = 73.9 bits (180), Expect = 7e-13 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSG+ERHKVHSHFGR LESGPYTLKYRGSMW Sbjct: 105 LLDQSGKERHKVHSHFGRTLESGPYTLKYRGSMW 138 >ref|XP_010090357.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis] gb|EXB39327.1| BTB/POZ and MATH domain-containing protein 2 [Morus notabilis] Length = 404 Score = 74.7 bits (182), Expect = 7e-13 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 LLDQSGRERHKVHSHFGR LESGPYTLKYRGSMW Sbjct: 109 LLDQSGRERHKVHSHFGRMLESGPYTLKYRGSMW 142 >ref|XP_011009015.1| PREDICTED: BTB/POZ and MATH domain-containing protein 2-like [Populus euphratica] Length = 409 Score = 74.7 bits (182), Expect = 7e-13 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 1 LLDQSGRERHKVHSHFGRALESGPYTLKYRGSMW 102 L+DQSG+ERHKVHSHFGRALESGPYTLKYRGSMW Sbjct: 110 LMDQSGKERHKVHSHFGRALESGPYTLKYRGSMW 143