BLASTX nr result
ID: Rehmannia31_contig00025034
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00025034 (422 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW88078.1| hypothetical protein EUGRSUZ_A00495 [Eucalyptus g... 63 7e-09 >gb|KCW88078.1| hypothetical protein EUGRSUZ_A00495 [Eucalyptus grandis] Length = 274 Score = 62.8 bits (151), Expect = 7e-09 Identities = 28/56 (50%), Positives = 38/56 (67%) Frame = -2 Query: 169 SARNPILMSTNSRRQQPSRRHQEWRGEPPIAISNISQRHQRISQILNHRKPLHHLL 2 S R+P+LMS N R +P RHQ+ EPP+ + N+ Q HQ ISQ+LN+ + LH LL Sbjct: 16 STRHPVLMSANQGRHEPRARHQKRTREPPLPVPNVGQGHQPISQVLNYGQLLHQLL 71