BLASTX nr result
ID: Rehmannia31_contig00024762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00024762 (363 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU45471.1| hypothetical protein MIMGU_mgv1a008875mg [Erythra... 58 2e-07 ref|XP_012840159.1| PREDICTED: probable protein phosphatase 2C 1... 58 2e-07 gb|PIN23266.1| Serine/threonine protein phosphatase [Handroanthu... 57 4e-07 ref|XP_011071351.1| probable protein phosphatase 2C 49 [Sesamum ... 57 4e-07 >gb|EYU45471.1| hypothetical protein MIMGU_mgv1a008875mg [Erythranthe guttata] Length = 360 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 3/45 (6%) Frame = +2 Query: 233 MVAEAELVCHPTVAVQYLCLPSPASPKTDSEFFDISAVA---PIS 358 MVAEAE++C TVAVQYLC+PSP SP+ ++ FD+S A PIS Sbjct: 1 MVAEAEIICQTTVAVQYLCVPSPTSPRLEANIFDVSKAATAEPIS 45 >ref|XP_012840159.1| PREDICTED: probable protein phosphatase 2C 13 [Erythranthe guttata] Length = 386 Score = 58.2 bits (139), Expect = 2e-07 Identities = 27/45 (60%), Positives = 34/45 (75%), Gaps = 3/45 (6%) Frame = +2 Query: 233 MVAEAELVCHPTVAVQYLCLPSPASPKTDSEFFDISAVA---PIS 358 MVAEAE++C TVAVQYLC+PSP SP+ ++ FD+S A PIS Sbjct: 1 MVAEAEIICQTTVAVQYLCVPSPTSPRLEANIFDVSKAATAEPIS 45 >gb|PIN23266.1| Serine/threonine protein phosphatase [Handroanthus impetiginosus] Length = 380 Score = 57.4 bits (137), Expect = 4e-07 Identities = 23/43 (53%), Positives = 32/43 (74%) Frame = +2 Query: 233 MVAEAELVCHPTVAVQYLCLPSPASPKTDSEFFDISAVAPISA 361 MVAEA+ CHP V VQYLC+PSP +++F+++SA AP +A Sbjct: 1 MVAEADFTCHPNVGVQYLCVPSPTPANIEADFYEVSAAAPPTA 43 >ref|XP_011071351.1| probable protein phosphatase 2C 49 [Sesamum indicum] Length = 385 Score = 57.4 bits (137), Expect = 4e-07 Identities = 22/36 (61%), Positives = 31/36 (86%) Frame = +2 Query: 233 MVAEAELVCHPTVAVQYLCLPSPASPKTDSEFFDIS 340 MVA+A++ CHPT+AVQYLCLPSP +PK + + FD++ Sbjct: 1 MVADAQVFCHPTLAVQYLCLPSPTAPKIEPDIFDVA 36