BLASTX nr result
ID: Rehmannia31_contig00024641
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00024641 (580 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22957.1| hypothetical protein MIMGU_mgv1a020951mg [Erythra... 60 3e-07 ref|XP_011069549.1| uncharacterized protein LOC105155376 isoform... 60 3e-07 ref|XP_011069548.1| uncharacterized protein LOC105155376 isoform... 60 3e-07 ref|XP_011069547.1| uncharacterized protein LOC105155376 isoform... 60 3e-07 ref|XP_011069545.1| uncharacterized protein LOC105155376 isoform... 60 3e-07 ref|XP_012854902.1| PREDICTED: uncharacterized protein LOC105974... 60 3e-07 ref|XP_012854901.1| PREDICTED: uncharacterized protein LOC105974... 60 3e-07 gb|PIN16178.1| hypothetical protein CDL12_11174 [Handroanthus im... 60 5e-07 >gb|EYU22957.1| hypothetical protein MIMGU_mgv1a020951mg [Erythranthe guttata] Length = 1140 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +2 Query: 209 TYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDLDRRHPKL 355 TYWP+LFDLD H IL +I WG PSQLSELVA++ VKS L + L Sbjct: 558 TYWPVLFDLDAGHSILPKLIEWGYPSQLSELVAEEVVKSLALTEENDGL 606 >ref|XP_011069549.1| uncharacterized protein LOC105155376 isoform X4 [Sesamum indicum] Length = 1314 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 209 TYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDL 334 T+WP+LFDLD HHIL VIH+G PS+LSELVA++ VKS L Sbjct: 740 THWPVLFDLDAAHHILPKVIHFGYPSKLSELVAEEVVKSLIL 781 >ref|XP_011069548.1| uncharacterized protein LOC105155376 isoform X3 [Sesamum indicum] Length = 1314 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 209 TYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDL 334 T+WP+LFDLD HHIL VIH+G PS+LSELVA++ VKS L Sbjct: 740 THWPVLFDLDAAHHILPKVIHFGYPSKLSELVAEEVVKSLIL 781 >ref|XP_011069547.1| uncharacterized protein LOC105155376 isoform X2 [Sesamum indicum] Length = 1315 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 209 TYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDL 334 T+WP+LFDLD HHIL VIH+G PS+LSELVA++ VKS L Sbjct: 742 THWPVLFDLDAAHHILPKVIHFGYPSKLSELVAEEVVKSLIL 783 >ref|XP_011069545.1| uncharacterized protein LOC105155376 isoform X1 [Sesamum indicum] Length = 1316 Score = 60.5 bits (145), Expect = 3e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = +2 Query: 209 TYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDL 334 T+WP+LFDLD HHIL VIH+G PS+LSELVA++ VKS L Sbjct: 742 THWPVLFDLDAAHHILPKVIHFGYPSKLSELVAEEVVKSLIL 783 >ref|XP_012854902.1| PREDICTED: uncharacterized protein LOC105974362 isoform X2 [Erythranthe guttata] Length = 1321 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +2 Query: 209 TYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDLDRRHPKL 355 TYWP+LFDLD H IL +I WG PSQLSELVA++ VKS L + L Sbjct: 739 TYWPVLFDLDAGHSILPKLIEWGYPSQLSELVAEEVVKSLALTEENDGL 787 >ref|XP_012854901.1| PREDICTED: uncharacterized protein LOC105974362 isoform X1 [Erythranthe guttata] Length = 1322 Score = 60.5 bits (145), Expect = 3e-07 Identities = 29/49 (59%), Positives = 34/49 (69%) Frame = +2 Query: 209 TYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDLDRRHPKL 355 TYWP+LFDLD H IL +I WG PSQLSELVA++ VKS L + L Sbjct: 739 TYWPVLFDLDAGHSILPKLIEWGYPSQLSELVAEEVVKSLALTEENDGL 787 >gb|PIN16178.1| hypothetical protein CDL12_11174 [Handroanthus impetiginosus] Length = 598 Score = 59.7 bits (143), Expect = 5e-07 Identities = 28/48 (58%), Positives = 34/48 (70%) Frame = +2 Query: 191 GPLHATTYWPLLFDLDGRHHILKSVIHWGGPSQLSELVADKNVKSFDL 334 G + TT WP+LFDLD HH L +IHWG PS+LSELVA++ KS L Sbjct: 501 GNEYRTTQWPVLFDLDAGHHNLPKLIHWGYPSKLSELVAEEVFKSLIL 548