BLASTX nr result
ID: Rehmannia31_contig00024534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00024534 (355 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEW07526.1| hypothetical protein 0_3988_01, partial [Pinus ra... 79 4e-17 gb|PPS15014.1| hypothetical protein GOBAR_AA05557 [Gossypium bar... 80 5e-17 gb|ABB03719.1| putative thioredoxin, partial [Sorghum bicolor] 80 5e-17 ref|XP_021652962.1| thioredoxin-like protein YLS8 isoform X3 [He... 80 5e-17 ref|XP_020534595.1| thioredoxin-like protein YLS8 isoform X2 [Ja... 80 5e-17 ref|XP_020422822.1| thioredoxin-like protein YLS8 isoform X2 [Pr... 80 5e-17 ref|XP_020108029.1| thioredoxin-like protein YLS8 isoform X2 [An... 80 5e-17 gb|OIT08303.1| thioredoxin-like protein yls8 [Nicotiana attenuata] 80 5e-17 gb|KDO52731.1| hypothetical protein CISIN_1g032338mg [Citrus sin... 80 5e-17 ref|XP_006661881.1| PREDICTED: thioredoxin-like protein YLS8 [Or... 80 5e-17 ref|XP_019068817.1| PREDICTED: thioredoxin-like protein YLS8 iso... 80 5e-17 ref|XP_021608513.1| thioredoxin-like protein YLS8 isoform X3 [Ma... 80 5e-17 ref|XP_022763928.1| thioredoxin-like protein YLS8 isoform X3 [Du... 80 5e-17 gb|ACL52911.1| unknown [Zea mays] 80 5e-17 gb|ESR50838.1| hypothetical protein CICLE_v10033145mg [Citrus cl... 80 5e-17 ref|XP_008777082.1| PREDICTED: thioredoxin-like protein YLS8 [Ph... 80 6e-17 ref|XP_022763927.1| thioredoxin-like protein YLS8 isoform X2 [Du... 80 6e-17 ref|XP_024196978.1| thioredoxin-like protein YLS8 isoform X2 [Ro... 80 6e-17 ref|NP_001331247.1| mRNA splicing factor, thioredoxin-like U5 sn... 79 7e-17 ref|XP_019058627.1| PREDICTED: thioredoxin-like protein YLS8 [Ta... 79 8e-17 >gb|AEW07526.1| hypothetical protein 0_3988_01, partial [Pinus radiata] gb|AFG58136.1| hypothetical protein 0_3988_01, partial [Pinus taeda] gb|AFG58137.1| hypothetical protein 0_3988_01, partial [Pinus taeda] gb|AFG58138.1| hypothetical protein 0_3988_01, partial [Pinus taeda] Length = 49 Score = 78.6 bits (192), Expect = 4e-17 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 A+KDKQEFIDI+ETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 12 AMKDKQEFIDIIETVYRGARKGRGLVIAPKDYSTKYRY 49 >gb|PPS15014.1| hypothetical protein GOBAR_AA05557 [Gossypium barbadense] Length = 99 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 62 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 99 >gb|ABB03719.1| putative thioredoxin, partial [Sorghum bicolor] Length = 99 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 62 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 99 >ref|XP_021652962.1| thioredoxin-like protein YLS8 isoform X3 [Hevea brasiliensis] ref|XP_021652963.1| thioredoxin-like protein YLS8 isoform X3 [Hevea brasiliensis] ref|XP_021652964.1| thioredoxin-like protein YLS8 isoform X3 [Hevea brasiliensis] ref|XP_021652965.1| thioredoxin-like protein YLS8 isoform X3 [Hevea brasiliensis] ref|XP_021652966.1| thioredoxin-like protein YLS8 isoform X3 [Hevea brasiliensis] ref|XP_021652967.1| thioredoxin-like protein YLS8 isoform X3 [Hevea brasiliensis] Length = 102 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 102 >ref|XP_020534595.1| thioredoxin-like protein YLS8 isoform X2 [Jatropha curcas] Length = 102 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 102 >ref|XP_020422822.1| thioredoxin-like protein YLS8 isoform X2 [Prunus persica] ref|XP_020422823.1| thioredoxin-like protein YLS8 isoform X2 [Prunus persica] ref|XP_020422824.1| thioredoxin-like protein YLS8 isoform X2 [Prunus persica] ref|XP_020422825.1| thioredoxin-like protein YLS8 isoform X2 [Prunus persica] Length = 102 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 102 >ref|XP_020108029.1| thioredoxin-like protein YLS8 isoform X2 [Ananas comosus] gb|OVA10696.1| mRNA splicing factor [Macleaya cordata] Length = 102 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 102 >gb|OIT08303.1| thioredoxin-like protein yls8 [Nicotiana attenuata] Length = 102 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 102 >gb|KDO52731.1| hypothetical protein CISIN_1g032338mg [Citrus sinensis] Length = 102 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 102 >ref|XP_006661881.1| PREDICTED: thioredoxin-like protein YLS8 [Oryza brachyantha] gb|OQU76073.1| hypothetical protein SORBI_3010G088600 [Sorghum bicolor] gb|OQU80425.1| hypothetical protein SORBI_3007G126200 [Sorghum bicolor] Length = 102 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 102 >ref|XP_019068817.1| PREDICTED: thioredoxin-like protein YLS8 isoform X2 [Solanum lycopersicum] Length = 103 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 66 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 103 >ref|XP_021608513.1| thioredoxin-like protein YLS8 isoform X3 [Manihot esculenta] Length = 104 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 67 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 104 >ref|XP_022763928.1| thioredoxin-like protein YLS8 isoform X3 [Durio zibethinus] gb|KOM46104.1| hypothetical protein LR48_Vigan06g141000 [Vigna angularis] Length = 104 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 67 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 104 >gb|ACL52911.1| unknown [Zea mays] Length = 104 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 67 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 104 >gb|ESR50838.1| hypothetical protein CICLE_v10033145mg [Citrus clementina] gb|KDO52730.1| hypothetical protein CISIN_1g032338mg [Citrus sinensis] Length = 104 Score = 79.7 bits (195), Expect = 5e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 67 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 104 >ref|XP_008777082.1| PREDICTED: thioredoxin-like protein YLS8 [Phoenix dactylifera] Length = 105 Score = 79.7 bits (195), Expect = 6e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 68 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 105 >ref|XP_022763927.1| thioredoxin-like protein YLS8 isoform X2 [Durio zibethinus] Length = 109 Score = 79.7 bits (195), Expect = 6e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 72 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 109 >ref|XP_024196978.1| thioredoxin-like protein YLS8 isoform X2 [Rosa chinensis] ref|XP_024196979.1| thioredoxin-like protein YLS8 isoform X2 [Rosa chinensis] ref|XP_024196980.1| thioredoxin-like protein YLS8 isoform X2 [Rosa chinensis] Length = 110 Score = 79.7 bits (195), Expect = 6e-17 Identities = 38/38 (100%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 73 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 110 >ref|NP_001331247.1| mRNA splicing factor, thioredoxin-like U5 snRNP [Arabidopsis thaliana] ref|XP_020977294.1| thioredoxin-like protein YLS8 isoform X2 [Arachis ipaensis] ref|XP_020996464.1| thioredoxin-like protein YLS8 isoform X2 [Arachis duranensis] gb|KGN50448.1| hypothetical protein Csa_5G175720 [Cucumis sativus] gb|ANM69580.1| mRNA splicing factor, thioredoxin-like U5 snRNP [Arabidopsis thaliana] Length = 102 Score = 79.3 bits (194), Expect = 7e-17 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDI+ETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 65 ALKDKQEFIDIIETVYRGARKGRGLVIAPKDYSTKYRY 102 >ref|XP_019058627.1| PREDICTED: thioredoxin-like protein YLS8 [Tarenaya hassleriana] Length = 104 Score = 79.3 bits (194), Expect = 8e-17 Identities = 37/38 (97%), Positives = 38/38 (100%) Frame = -3 Query: 353 ALKDKQEFIDIVETVYRGARKGRGLVIAPKDYSTKYRY 240 ALKDKQEFIDI+ETVYRGARKGRGLVIAPKDYSTKYRY Sbjct: 67 ALKDKQEFIDIIETVYRGARKGRGLVIAPKDYSTKYRY 104