BLASTX nr result
ID: Rehmannia31_contig00024492
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00024492 (426 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM97967.1| CREB binding protein/P300 [Handroanthus impetigin... 84 3e-16 ref|XP_011073991.1| BTB/POZ and TAZ domain-containing protein 3 ... 74 2e-12 ref|XP_012839051.1| PREDICTED: BTB/POZ and TAZ domain-containing... 71 2e-11 >gb|PIM97967.1| CREB binding protein/P300 [Handroanthus impetiginosus] Length = 360 Score = 84.0 bits (206), Expect = 3e-16 Identities = 43/72 (59%), Positives = 49/72 (68%) Frame = -1 Query: 216 MGSPTVDISWPSSIIESFDRSFDIQIEEGNSSDTLDFLENTKPSAYYNQXXXXXXXXXXX 37 MGSP VDISWPSSI++SFD+SFDIQIEEGNSSDT D L+NTK SA+Y+ Sbjct: 1 MGSPVVDISWPSSIVDSFDQSFDIQIEEGNSSDTSDSLDNTKSSAFYHHNIPKPPPLPMK 60 Query: 36 XXXXXLAKSCCV 1 LAK C V Sbjct: 61 NSNRGLAKCCYV 72 >ref|XP_011073991.1| BTB/POZ and TAZ domain-containing protein 3 [Sesamum indicum] ref|XP_011073992.1| BTB/POZ and TAZ domain-containing protein 3 [Sesamum indicum] ref|XP_020548218.1| BTB/POZ and TAZ domain-containing protein 3 [Sesamum indicum] ref|XP_020548219.1| BTB/POZ and TAZ domain-containing protein 3 [Sesamum indicum] Length = 408 Score = 73.6 bits (179), Expect = 2e-12 Identities = 37/72 (51%), Positives = 46/72 (63%) Frame = -1 Query: 216 MGSPTVDISWPSSIIESFDRSFDIQIEEGNSSDTLDFLENTKPSAYYNQXXXXXXXXXXX 37 MGSP VDISWPSS IESFDR FDIQIEEGNSS L ++++TK S++++ Sbjct: 1 MGSPAVDISWPSSFIESFDRPFDIQIEEGNSSTALTYVDDTKLSSFHHHNIPKPPPPPRK 60 Query: 36 XXXXXLAKSCCV 1 LAK C + Sbjct: 61 NLNRGLAKHCSI 72 >ref|XP_012839051.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Erythranthe guttata] ref|XP_012839052.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Erythranthe guttata] ref|XP_012839053.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 3 [Erythranthe guttata] gb|EYU36669.1| hypothetical protein MIMGU_mgv1a007664mg [Erythranthe guttata] Length = 399 Score = 70.9 bits (172), Expect = 2e-11 Identities = 34/44 (77%), Positives = 36/44 (81%) Frame = -1 Query: 216 MGSPTVDISWPSSIIESFDRSFDIQIEEGNSSDTLDFLENTKPS 85 MGSP DISWPSS+IESFDRSFDI IEEGNSSD FLE+ PS Sbjct: 1 MGSPGADISWPSSVIESFDRSFDINIEEGNSSDISYFLEDKMPS 44