BLASTX nr result
ID: Rehmannia31_contig00024350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00024350 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841688.1| PREDICTED: uncharacterized protein LOC105961... 67 6e-11 >ref|XP_012841688.1| PREDICTED: uncharacterized protein LOC105961976 [Erythranthe guttata] gb|EYU33554.1| hypothetical protein MIMGU_mgv1a014008mg [Erythranthe guttata] Length = 203 Score = 66.6 bits (161), Expect = 6e-11 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = -1 Query: 364 IGVVWERDKNPEDVIRVFMMKEFFGTRFFDDLVVHELARG-KGKK 233 + V DK+PEDVIR FMMKEFFG RFFDDL+VHELAR KGKK Sbjct: 155 VSKVLATDKSPEDVIRTFMMKEFFGVRFFDDLMVHELARATKGKK 199