BLASTX nr result
ID: Rehmannia31_contig00024097
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00024097 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99473.1| Multitransmembrane protein [Handroanthus impetigi... 54 7e-06 >gb|PIM99473.1| Multitransmembrane protein [Handroanthus impetiginosus] Length = 242 Score = 54.3 bits (129), Expect = 7e-06 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 328 HQVFYVQI*GNIVSFMVILAPIPTFYQIYKKKSS 429 H VF + GNI+SFMV LAPIPTFYQIYKKKSS Sbjct: 7 HWVFAFGLLGNIISFMVYLAPIPTFYQIYKKKSS 40