BLASTX nr result
ID: Rehmannia31_contig00023620
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00023620 (402 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096740.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum... 115 7e-28 ref|XP_022873553.1| UDP-arabinose 4-epimerase 1-like [Olea europ... 107 1e-26 gb|KZV58291.1| UDP-arabinose 4-epimerase 1 [Dorcoceras hygrometr... 109 1e-25 gb|PIN17743.1| UDP-glucose 4-epimerase/UDP-sulfoquinovose syntha... 108 3e-25 ref|XP_022873546.1| UDP-arabinose 4-epimerase 1 [Olea europaea v... 107 5e-25 ref|XP_012827591.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Eryt... 107 5e-25 gb|PHT63877.1| putative UDP-arabinose 4-epimerase 3 [Capsicum an... 107 7e-25 ref|XP_016559330.1| PREDICTED: UDP-arabinose 4-epimerase 1-like ... 107 7e-25 gb|PHT55499.1| UDP-arabinose 4-epimerase 1 [Capsicum baccatum] 106 1e-24 gb|PHU25756.1| putative UDP-arabinose 4-epimerase 3 [Capsicum ch... 106 2e-24 ref|XP_022847933.1| UDP-arabinose 4-epimerase 1-like [Olea europ... 105 3e-24 ref|XP_002529901.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Rici... 105 5e-24 ref|XP_010315646.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 103 6e-24 gb|KZV21655.1| UDP-arabinose 4-epimerase 1-like [Dorcoceras hygr... 103 8e-24 ref|XP_022142585.1| UDP-arabinose 4-epimerase 1-like [Momordica ... 103 1e-23 ref|XP_010315644.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 103 2e-23 ref|XP_019067695.1| PREDICTED: UDP-arabinose 4-epimerase 1 isofo... 103 2e-23 ref|XP_024157673.1| UDP-arabinose 4-epimerase 1 isoform X2 [Rosa... 103 2e-23 ref|XP_008225692.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Prun... 103 2e-23 ref|XP_007211748.1| UDP-arabinose 4-epimerase 1 [Prunus persica]... 103 2e-23 >ref|XP_011096740.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_011096741.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_011096742.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] ref|XP_011096743.1| UDP-arabinose 4-epimerase 1 [Sesamum indicum] Length = 417 Score = 115 bits (288), Expect = 7e-28 Identities = 51/57 (89%), Positives = 55/57 (96%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KIKNELNWTAKHT+LQ+SLQ+AWRWQKAHLNGY PLVMSA Sbjct: 361 LPRRPGDYAEVYSDPTKIKNELNWTAKHTDLQESLQVAWRWQKAHLNGYGTPLVMSA 417 >ref|XP_022873553.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] Length = 195 Score = 107 bits (268), Expect = 1e-26 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KI++ELNWTAKHT+LQ+SLQIAWRWQKAHLNGY P V SA Sbjct: 139 LPRRPGDYAEVYSDPTKIRDELNWTAKHTDLQKSLQIAWRWQKAHLNGYGTPQVSSA 195 >gb|KZV58291.1| UDP-arabinose 4-epimerase 1 [Dorcoceras hygrometricum] Length = 417 Score = 109 bits (272), Expect = 1e-25 Identities = 49/57 (85%), Positives = 53/57 (92%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KIKNELNWTAK+TNLQ+SLQ AW WQKAH NGY APL+MSA Sbjct: 361 LPRRPGDYAEVYSDPTKIKNELNWTAKYTNLQESLQTAWSWQKAHPNGYAAPLLMSA 417 >gb|PIN17743.1| UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Handroanthus impetiginosus] Length = 417 Score = 108 bits (270), Expect = 3e-25 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEV+SDP+KIKNELNWTAKHT+L +SL+IAWRWQKAH NGY PLVMSA Sbjct: 361 LPRRPGDYAEVFSDPTKIKNELNWTAKHTDLLESLRIAWRWQKAHRNGYSTPLVMSA 417 >ref|XP_022873546.1| UDP-arabinose 4-epimerase 1 [Olea europaea var. sylvestris] ref|XP_022873547.1| UDP-arabinose 4-epimerase 1 [Olea europaea var. sylvestris] ref|XP_022873548.1| UDP-arabinose 4-epimerase 1 [Olea europaea var. sylvestris] ref|XP_022873549.1| UDP-arabinose 4-epimerase 1 [Olea europaea var. sylvestris] Length = 417 Score = 107 bits (268), Expect = 5e-25 Identities = 48/57 (84%), Positives = 53/57 (92%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KI++ELNWTAKHT+LQ+SLQIAWRWQKAHLNGY P V SA Sbjct: 361 LPRRPGDYAEVYSDPTKIRDELNWTAKHTDLQKSLQIAWRWQKAHLNGYGTPQVSSA 417 >ref|XP_012827591.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttata] ref|XP_012827592.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttata] ref|XP_012827593.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Erythranthe guttata] gb|EYU19070.1| hypothetical protein MIMGU_mgv1a007125mg [Erythranthe guttata] Length = 418 Score = 107 bits (268), Expect = 5e-25 Identities = 51/58 (87%), Positives = 55/58 (94%), Gaps = 1/58 (1%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGY-EAPLVMSA 176 LPRRPGDYAEVYS+P+KI +ELNWTAK+TNLQQSLQIAWRWQKAHLNGY APLVMSA Sbjct: 361 LPRRPGDYAEVYSNPTKINSELNWTAKYTNLQQSLQIAWRWQKAHLNGYGGAPLVMSA 418 >gb|PHT63877.1| putative UDP-arabinose 4-epimerase 3 [Capsicum annuum] Length = 417 Score = 107 bits (267), Expect = 7e-25 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KIK ELNWTAKHT+LQ+SLQ+AWRWQK+HLNGYE+ LV S+ Sbjct: 361 LPRRPGDYAEVYSDPTKIKLELNWTAKHTDLQESLQVAWRWQKSHLNGYESSLVSSS 417 >ref|XP_016559330.1| PREDICTED: UDP-arabinose 4-epimerase 1-like [Capsicum annuum] Length = 417 Score = 107 bits (267), Expect = 7e-25 Identities = 47/57 (82%), Positives = 54/57 (94%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KIK ELNWTAKHT+LQ+SLQ+AWRWQK+HLNGYE+ LV S+ Sbjct: 361 LPRRPGDYAEVYSDPTKIKLELNWTAKHTDLQESLQVAWRWQKSHLNGYESSLVSSS 417 >gb|PHT55499.1| UDP-arabinose 4-epimerase 1 [Capsicum baccatum] Length = 369 Score = 106 bits (264), Expect = 1e-24 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KIK ELNWTAKHT+LQ+SLQ+AWRWQK+HLNGY++ LV S+ Sbjct: 313 LPRRPGDYAEVYSDPTKIKLELNWTAKHTDLQESLQVAWRWQKSHLNGYDSSLVSSS 369 >gb|PHU25756.1| putative UDP-arabinose 4-epimerase 3 [Capsicum chinense] Length = 417 Score = 106 bits (264), Expect = 2e-24 Identities = 46/57 (80%), Positives = 54/57 (94%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KIK ELNWTAKHT+LQ+SLQ+AWRWQK+HLNGY++ LV S+ Sbjct: 361 LPRRPGDYAEVYSDPTKIKLELNWTAKHTDLQESLQVAWRWQKSHLNGYDSSLVSSS 417 >ref|XP_022847933.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] ref|XP_022847934.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] ref|XP_022847935.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] ref|XP_022847936.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] ref|XP_022847937.1| UDP-arabinose 4-epimerase 1-like [Olea europaea var. sylvestris] Length = 417 Score = 105 bits (263), Expect = 3e-24 Identities = 47/57 (82%), Positives = 52/57 (91%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KI+ ELNWTA+HT+LQ+SLQIAWRWQKAHLNGY P V SA Sbjct: 361 LPRRPGDYAEVYSDPTKIREELNWTAQHTDLQKSLQIAWRWQKAHLNGYGTPQVSSA 417 >ref|XP_002529901.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Ricinus communis] ref|XP_015581283.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Ricinus communis] ref|XP_015581284.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Ricinus communis] gb|EEF32504.1| UDP-glucose 4-epimerase, putative [Ricinus communis] Length = 417 Score = 105 bits (261), Expect = 5e-24 Identities = 45/57 (78%), Positives = 54/57 (94%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDP+KI+ ELNWTA+HT+LQ+SLQ+AWRWQKAH NGY +PLVM++ Sbjct: 361 LPRRPGDYAEVYSDPTKIRVELNWTAQHTDLQESLQVAWRWQKAHRNGYGSPLVMAS 417 >ref|XP_010315646.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X6 [Solanum lycopersicum] Length = 305 Score = 103 bits (256), Expect = 6e-24 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 173 LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 250 LPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 305 >gb|KZV21655.1| UDP-arabinose 4-epimerase 1-like [Dorcoceras hygrometricum] Length = 368 Score = 103 bits (258), Expect = 8e-24 Identities = 46/53 (86%), Positives = 49/53 (92%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPL 164 LPRRPGDYAEVYSDP+KIKNELNWTAK+TNLQ+SLQ AWRWQKAHLNGY L Sbjct: 311 LPRRPGDYAEVYSDPTKIKNELNWTAKYTNLQESLQTAWRWQKAHLNGYGTTL 363 >ref|XP_022142585.1| UDP-arabinose 4-epimerase 1-like [Momordica charantia] ref|XP_022142586.1| UDP-arabinose 4-epimerase 1-like [Momordica charantia] Length = 417 Score = 103 bits (258), Expect = 1e-23 Identities = 45/57 (78%), Positives = 53/57 (92%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEV+S+P+KIKNELNWTA+HT LQ+SLQ+AWRWQK+HLNGY LVMS+ Sbjct: 361 LPRRPGDYAEVFSNPTKIKNELNWTAQHTELQESLQVAWRWQKSHLNGYGNSLVMSS 417 >ref|XP_010315644.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X5 [Solanum lycopersicum] ref|XP_010315645.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X5 [Solanum lycopersicum] Length = 365 Score = 103 bits (256), Expect = 2e-23 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 173 LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 310 LPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 365 >ref|XP_019067695.1| PREDICTED: UDP-arabinose 4-epimerase 1 isoform X4 [Solanum lycopersicum] Length = 366 Score = 103 bits (256), Expect = 2e-23 Identities = 45/56 (80%), Positives = 51/56 (91%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMS 173 LPRRPGDYAEVYSDP+KI+NELNWTAK+T+LQQSLQIAWRWQK+HLNGY + S Sbjct: 311 LPRRPGDYAEVYSDPTKIRNELNWTAKYTDLQQSLQIAWRWQKSHLNGYSLSVATS 366 >ref|XP_024157673.1| UDP-arabinose 4-epimerase 1 isoform X2 [Rosa chinensis] Length = 379 Score = 103 bits (256), Expect = 2e-23 Identities = 44/57 (77%), Positives = 52/57 (91%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVMSA 176 LPRRPGDYAEVYSDPSKI ELNWTA+HTNLQ+SLQ+AWRWQK+H +GY P+V+S+ Sbjct: 323 LPRRPGDYAEVYSDPSKILRELNWTAQHTNLQESLQVAWRWQKSHRDGYGTPMVVSS 379 >ref|XP_008225692.1| PREDICTED: UDP-arabinose 4-epimerase 1 [Prunus mume] Length = 417 Score = 103 bits (257), Expect = 2e-23 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVM 170 LPRRPGDYAEVYSDPSKI ELNWTA+HTNLQ+SLQ+AWRWQK+H +GY PLVM Sbjct: 361 LPRRPGDYAEVYSDPSKILRELNWTAQHTNLQESLQVAWRWQKSHRDGYGTPLVM 415 >ref|XP_007211748.1| UDP-arabinose 4-epimerase 1 [Prunus persica] ref|XP_020417691.1| UDP-arabinose 4-epimerase 1 [Prunus persica] ref|XP_020417692.1| UDP-arabinose 4-epimerase 1 [Prunus persica] ref|XP_020417693.1| UDP-arabinose 4-epimerase 1 [Prunus persica] gb|AGH25534.1| UDP-D-xylose 4-epimerase [Prunus persica] gb|ONI11324.1| hypothetical protein PRUPE_4G101700 [Prunus persica] gb|ONI11325.1| hypothetical protein PRUPE_4G101700 [Prunus persica] gb|ONI11326.1| hypothetical protein PRUPE_4G101700 [Prunus persica] gb|ONI11327.1| hypothetical protein PRUPE_4G101700 [Prunus persica] gb|ONI11328.1| hypothetical protein PRUPE_4G101700 [Prunus persica] gb|ONI11329.1| hypothetical protein PRUPE_4G101700 [Prunus persica] gb|ONI11330.1| hypothetical protein PRUPE_4G101700 [Prunus persica] gb|ONI11331.1| hypothetical protein PRUPE_4G101700 [Prunus persica] Length = 417 Score = 103 bits (257), Expect = 2e-23 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = +3 Query: 6 LPRRPGDYAEVYSDPSKIKNELNWTAKHTNLQQSLQIAWRWQKAHLNGYEAPLVM 170 LPRRPGDYAEVYSDPSKI ELNWTA+HTNLQ+SLQ+AWRWQK+H +GY PLVM Sbjct: 361 LPRRPGDYAEVYSDPSKILRELNWTAQHTNLQESLQVAWRWQKSHRDGYGTPLVM 415