BLASTX nr result
ID: Rehmannia31_contig00023431
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00023431 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020553007.1| uncharacterized GPI-anchored protein At1g619... 67 6e-10 ref|XP_011091606.1| uncharacterized GPI-anchored protein At1g619... 67 6e-10 ref|XP_022849363.1| uncharacterized GPI-anchored protein At1g619... 55 5e-06 >ref|XP_020553007.1| uncharacterized GPI-anchored protein At1g61900 isoform X2 [Sesamum indicum] Length = 465 Score = 66.6 bits (161), Expect = 6e-10 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 311 MDRVTTITRLKGSWLHLSLQFVFWLCSLGSILALQTPPEPSHISSA 448 MD V T TRLKGSW H LQF WLCS ++LAL+TP E SHISSA Sbjct: 1 MDCVKTATRLKGSWFHWLLQFTIWLCSFENVLALETPQESSHISSA 46 >ref|XP_011091606.1| uncharacterized GPI-anchored protein At1g61900 isoform X1 [Sesamum indicum] Length = 470 Score = 66.6 bits (161), Expect = 6e-10 Identities = 31/46 (67%), Positives = 34/46 (73%) Frame = +2 Query: 311 MDRVTTITRLKGSWLHLSLQFVFWLCSLGSILALQTPPEPSHISSA 448 MD V T TRLKGSW H LQF WLCS ++LAL+TP E SHISSA Sbjct: 1 MDCVKTATRLKGSWFHWLLQFTIWLCSFENVLALETPQESSHISSA 46 >ref|XP_022849363.1| uncharacterized GPI-anchored protein At1g61900-like [Olea europaea var. sylvestris] Length = 469 Score = 55.5 bits (132), Expect = 5e-06 Identities = 28/45 (62%), Positives = 32/45 (71%) Frame = +2 Query: 311 MDRVTTITRLKGSWLHLSLQFVFWLCSLGSILALQTPPEPSHISS 445 MD V T TR+KGS+ H L F WL S ++LALQT PEPSHISS Sbjct: 1 MDCVKTATRVKGSFSHQLLIFAVWLSSFRNVLALQTLPEPSHISS 45