BLASTX nr result
ID: Rehmannia31_contig00023293
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00023293 (365 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087684.1| uncharacterized protein LOC105169093 [Sesamu... 77 8e-14 ref|XP_012850326.1| PREDICTED: bromodomain-containing protein 3 ... 69 6e-11 gb|PIN18596.1| hypothetical protein CDL12_08731 [Handroanthus im... 67 2e-10 ref|XP_022895668.1| uncharacterized protein LOC111409825 isoform... 55 3e-06 ref|XP_022895665.1| uncharacterized protein LOC111409825 isoform... 55 3e-06 >ref|XP_011087684.1| uncharacterized protein LOC105169093 [Sesamum indicum] ref|XP_011087685.1| uncharacterized protein LOC105169093 [Sesamum indicum] Length = 579 Score = 76.6 bits (187), Expect = 8e-14 Identities = 37/44 (84%), Positives = 38/44 (86%) Frame = -2 Query: 139 LVSATEVASNVVSLNTEVNSGADEFDNEEVDSGMDAEAETTPSP 8 LVS EVASNVVSLNTE NSG DEFDNEE+DSGMDAE E TPSP Sbjct: 17 LVSTNEVASNVVSLNTEENSGVDEFDNEEIDSGMDAETEATPSP 60 >ref|XP_012850326.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttata] ref|XP_012850327.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttata] ref|XP_012850328.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttata] ref|XP_012850329.1| PREDICTED: bromodomain-containing protein 3 [Erythranthe guttata] gb|EYU26479.1| hypothetical protein MIMGU_mgv1a003392mg [Erythranthe guttata] Length = 588 Score = 68.6 bits (166), Expect = 6e-11 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -2 Query: 139 LVSATEVASNVVSLNTEVNSGADEFDNEEVDSGMDAEAETTPSPP 5 L EV SNV+S+NTE NSG DEFDNEE+DSGM+AE E TPSPP Sbjct: 17 LAPTNEVPSNVISVNTEDNSGLDEFDNEEMDSGMNAETEKTPSPP 61 >gb|PIN18596.1| hypothetical protein CDL12_08731 [Handroanthus impetiginosus] Length = 569 Score = 67.0 bits (162), Expect = 2e-10 Identities = 34/44 (77%), Positives = 35/44 (79%) Frame = -2 Query: 139 LVSATEVASNVVSLNTEVNSGADEFDNEEVDSGMDAEAETTPSP 8 LVS E ASNVVS+NT NSG D DNEE DSGMDAEAETTPSP Sbjct: 17 LVSTNEAASNVVSINTGDNSGLDGNDNEEADSGMDAEAETTPSP 60 >ref|XP_022895668.1| uncharacterized protein LOC111409825 isoform X2 [Olea europaea var. sylvestris] Length = 559 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 139 LVSATEVASNVVSLNTEVNSGADEFDNEEVDSGMDAEAETTPS 11 LVS E++SNVVSLNTE N DEFDN++VDSG+DAE +PS Sbjct: 17 LVSTNEISSNVVSLNTEDNP--DEFDNDDVDSGLDAETMPSPS 57 >ref|XP_022895665.1| uncharacterized protein LOC111409825 isoform X1 [Olea europaea var. sylvestris] ref|XP_022895666.1| uncharacterized protein LOC111409825 isoform X1 [Olea europaea var. sylvestris] Length = 560 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/43 (65%), Positives = 34/43 (79%) Frame = -2 Query: 139 LVSATEVASNVVSLNTEVNSGADEFDNEEVDSGMDAEAETTPS 11 LVS E++SNVVSLNTE N DEFDN++VDSG+DAE +PS Sbjct: 17 LVSTNEISSNVVSLNTEDNP--DEFDNDDVDSGLDAETMPSPS 57