BLASTX nr result
ID: Rehmannia31_contig00023113
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00023113 (381 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095504.1| uncharacterized protein LOC105174942 [Sesamu... 60 5e-08 >ref|XP_011095504.1| uncharacterized protein LOC105174942 [Sesamum indicum] ref|XP_020553913.1| uncharacterized protein LOC105174942 [Sesamum indicum] Length = 258 Score = 59.7 bits (143), Expect = 5e-08 Identities = 37/64 (57%), Positives = 44/64 (68%), Gaps = 9/64 (14%) Frame = +3 Query: 213 MNGIWISLKGSMNCGS--TDVARLPEKM---RSSTSPD-EEFKNEVTHP---FKFRHYCM 365 MN IWISLK ++NCGS TDVARLPEKM RSSTS + + +E P KFRHY + Sbjct: 1 MNSIWISLKENINCGSKMTDVARLPEKMARRRSSTSAERNQLTDEHESPLLQLKFRHYPI 60 Query: 366 RNRF 377 R+RF Sbjct: 61 RSRF 64