BLASTX nr result
ID: Rehmannia31_contig00023075
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00023075 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099112.1| uncharacterized protein LOC105177601 [Sesamu... 80 1e-14 gb|EPS61716.1| hypothetical protein M569_13081, partial [Genlise... 74 2e-14 ref|XP_022846103.1| uncharacterized protein LOC111368855 isoform... 76 2e-13 ref|XP_022846101.1| uncharacterized protein LOC111368855 isoform... 76 2e-13 ref|XP_016697240.1| PREDICTED: uncharacterized protein LOC107913... 75 4e-13 ref|XP_012853530.1| PREDICTED: uncharacterized protein LOC105973... 75 9e-13 ref|XP_016679250.1| PREDICTED: uncharacterized protein LOC107898... 74 2e-12 gb|KJB43783.1| hypothetical protein B456_007G215700 [Gossypium r... 74 2e-12 gb|KZV22109.1| hypothetical protein F511_11637 [Dorcoceras hygro... 74 2e-12 gb|KVH92511.1| hypothetical protein Ccrd_005451 [Cynara carduncu... 74 2e-12 ref|XP_012491846.1| PREDICTED: uncharacterized protein LOC105803... 74 2e-12 ref|XP_017626779.1| PREDICTED: uncharacterized protein LOC108470... 74 2e-12 ref|XP_022012977.1| uncharacterized protein LOC110912535 [Helian... 74 2e-12 gb|ONI02983.1| hypothetical protein PRUPE_6G231900 [Prunus persi... 72 3e-12 emb|CDP02512.1| unnamed protein product [Coffea canephora] 73 3e-12 gb|ONI02985.1| hypothetical protein PRUPE_6G231900 [Prunus persi... 72 3e-12 gb|ACU23960.1| unknown [Glycine max] 72 4e-12 gb|ONI02981.1| hypothetical protein PRUPE_6G231900 [Prunus persica] 72 4e-12 gb|ONI02982.1| hypothetical protein PRUPE_6G231900 [Prunus persica] 72 4e-12 ref|XP_018845001.1| PREDICTED: uncharacterized protein LOC109009... 73 4e-12 >ref|XP_011099112.1| uncharacterized protein LOC105177601 [Sesamum indicum] ref|XP_011099113.1| uncharacterized protein LOC105177601 [Sesamum indicum] ref|XP_011099114.1| uncharacterized protein LOC105177601 [Sesamum indicum] ref|XP_020554946.1| uncharacterized protein LOC105177601 [Sesamum indicum] ref|XP_020554947.1| uncharacterized protein LOC105177601 [Sesamum indicum] Length = 343 Score = 80.1 bits (196), Expect = 1e-14 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK Sbjct: 87 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 123 >gb|EPS61716.1| hypothetical protein M569_13081, partial [Genlisea aurea] Length = 92 Score = 74.3 bits (181), Expect = 2e-14 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 +NNSGS+TALLRWPTAPT MEMPVV+VRKYGVWLLAK Sbjct: 56 RNNSGSITALLRWPTAPTWMEMPVVQVRKYGVWLLAK 92 >ref|XP_022846103.1| uncharacterized protein LOC111368855 isoform X2 [Olea europaea var. sylvestris] Length = 297 Score = 76.3 bits (186), Expect = 2e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KNNSGSVTALLRWPTAP GMEMPVVEV KYGVWLLAK Sbjct: 86 KNNSGSVTALLRWPTAPAGMEMPVVEVHKYGVWLLAK 122 >ref|XP_022846101.1| uncharacterized protein LOC111368855 isoform X1 [Olea europaea var. sylvestris] Length = 324 Score = 76.3 bits (186), Expect = 2e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KNNSGSVTALLRWPTAP GMEMPVVEV KYGVWLLAK Sbjct: 86 KNNSGSVTALLRWPTAPAGMEMPVVEVHKYGVWLLAK 122 >ref|XP_016697240.1| PREDICTED: uncharacterized protein LOC107913228 [Gossypium hirsutum] Length = 324 Score = 75.5 bits (184), Expect = 4e-13 Identities = 34/37 (91%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 +NNSG+VTALLRWPTAPTGMEMPVVEVRK+GVWLLAK Sbjct: 71 QNNSGAVTALLRWPTAPTGMEMPVVEVRKHGVWLLAK 107 >ref|XP_012853530.1| PREDICTED: uncharacterized protein LOC105973068 [Erythranthe guttata] gb|EYU44419.1| hypothetical protein MIMGU_mgv1a009413mg [Erythranthe guttata] Length = 343 Score = 74.7 bits (182), Expect = 9e-13 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN SGSVTALLRWPTAP GMEMPVVEVRKYGVWLL+K Sbjct: 87 KNKSGSVTALLRWPTAPAGMEMPVVEVRKYGVWLLSK 123 >ref|XP_016679250.1| PREDICTED: uncharacterized protein LOC107898227 [Gossypium hirsutum] Length = 307 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 ++NSG+VTALLRWPTAPTGMEMPVVEVRK+GVWLLAK Sbjct: 54 QSNSGAVTALLRWPTAPTGMEMPVVEVRKHGVWLLAK 90 >gb|KJB43783.1| hypothetical protein B456_007G215700 [Gossypium raimondii] Length = 307 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 ++NSG+VTALLRWPTAPTGMEMPVVEVRK+GVWLLAK Sbjct: 54 QSNSGAVTALLRWPTAPTGMEMPVVEVRKHGVWLLAK 90 >gb|KZV22109.1| hypothetical protein F511_11637 [Dorcoceras hygrometricum] Length = 599 Score = 74.3 bits (181), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KNNSGSVTALLRWPTAP GMEMPVVEV KYGVWLL+K Sbjct: 343 KNNSGSVTALLRWPTAPVGMEMPVVEVLKYGVWLLSK 379 >gb|KVH92511.1| hypothetical protein Ccrd_005451 [Cynara cardunculus var. scolymus] Length = 384 Score = 73.9 bits (180), Expect = 2e-12 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN+SGSVTALLRWPTAP GMEMPVVEVR YGVWLLAK Sbjct: 161 KNSSGSVTALLRWPTAPPGMEMPVVEVRSYGVWLLAK 197 >ref|XP_012491846.1| PREDICTED: uncharacterized protein LOC105803940 [Gossypium raimondii] gb|KJB43782.1| hypothetical protein B456_007G215700 [Gossypium raimondii] Length = 338 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 ++NSG+VTALLRWPTAPTGMEMPVVEVRK+GVWLLAK Sbjct: 85 QSNSGAVTALLRWPTAPTGMEMPVVEVRKHGVWLLAK 121 >ref|XP_017626779.1| PREDICTED: uncharacterized protein LOC108470084 [Gossypium arboreum] gb|KHG09679.1| CTP synthase [Gossypium arboreum] Length = 338 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/37 (89%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 ++NSG+VTALLRWPTAPTGMEMPVVEVRK+GVWLLAK Sbjct: 85 QSNSGAVTALLRWPTAPTGMEMPVVEVRKHGVWLLAK 121 >ref|XP_022012977.1| uncharacterized protein LOC110912535 [Helianthus annuus] gb|OTF96134.1| hypothetical protein HannXRQ_Chr15g0490761 [Helianthus annuus] Length = 347 Score = 73.6 bits (179), Expect = 2e-12 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KNN GSVTALLRWPTAP GMEMPVVEVR YGVWLLAK Sbjct: 90 KNNLGSVTALLRWPTAPPGMEMPVVEVRSYGVWLLAK 126 >gb|ONI02983.1| hypothetical protein PRUPE_6G231900 [Prunus persica] gb|ONI02984.1| hypothetical protein PRUPE_6G231900 [Prunus persica] Length = 265 Score = 72.4 bits (176), Expect = 3e-12 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN+SG+VTALLRWPTAP+GM+MPVVEVRK+GVWLLAK Sbjct: 81 KNSSGAVTALLRWPTAPSGMDMPVVEVRKHGVWLLAK 117 >emb|CDP02512.1| unnamed protein product [Coffea canephora] Length = 343 Score = 73.2 bits (178), Expect = 3e-12 Identities = 32/37 (86%), Positives = 36/37 (97%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 +N SGSVTALLRWPTAPTGMEMPV++V+KYGVWLLAK Sbjct: 87 ENTSGSVTALLRWPTAPTGMEMPVIQVQKYGVWLLAK 123 >gb|ONI02985.1| hypothetical protein PRUPE_6G231900 [Prunus persica] gb|ONI02986.1| hypothetical protein PRUPE_6G231900 [Prunus persica] Length = 272 Score = 72.4 bits (176), Expect = 3e-12 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN+SG+VTALLRWPTAP+GM+MPVVEVRK+GVWLLAK Sbjct: 88 KNSSGAVTALLRWPTAPSGMDMPVVEVRKHGVWLLAK 124 >gb|ACU23960.1| unknown [Glycine max] Length = 230 Score = 71.6 bits (174), Expect = 4e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN+SG+VTALLRWPTAP MEMPVVEVRKYGVWLLAK Sbjct: 90 KNSSGNVTALLRWPTAPPEMEMPVVEVRKYGVWLLAK 126 >gb|ONI02981.1| hypothetical protein PRUPE_6G231900 [Prunus persica] Length = 290 Score = 72.4 bits (176), Expect = 4e-12 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN+SG+VTALLRWPTAP+GM+MPVVEVRK+GVWLLAK Sbjct: 81 KNSSGAVTALLRWPTAPSGMDMPVVEVRKHGVWLLAK 117 >gb|ONI02982.1| hypothetical protein PRUPE_6G231900 [Prunus persica] Length = 297 Score = 72.4 bits (176), Expect = 4e-12 Identities = 32/37 (86%), Positives = 37/37 (100%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN+SG+VTALLRWPTAP+GM+MPVVEVRK+GVWLLAK Sbjct: 88 KNSSGAVTALLRWPTAPSGMDMPVVEVRKHGVWLLAK 124 >ref|XP_018845001.1| PREDICTED: uncharacterized protein LOC109009099 isoform X2 [Juglans regia] Length = 343 Score = 72.8 bits (177), Expect = 4e-12 Identities = 33/37 (89%), Positives = 36/37 (97%) Frame = +3 Query: 3 KNNSGSVTALLRWPTAPTGMEMPVVEVRKYGVWLLAK 113 KN+SG+VTALLRWPTAP GMEMPVVEVRK+GVWLLAK Sbjct: 88 KNSSGAVTALLRWPTAPPGMEMPVVEVRKHGVWLLAK 124