BLASTX nr result
ID: Rehmannia31_contig00022665
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00022665 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012841688.1| PREDICTED: uncharacterized protein LOC105961... 66 2e-10 >ref|XP_012841688.1| PREDICTED: uncharacterized protein LOC105961976 [Erythranthe guttata] gb|EYU33554.1| hypothetical protein MIMGU_mgv1a014008mg [Erythranthe guttata] Length = 203 Score = 65.9 bits (159), Expect = 2e-10 Identities = 31/39 (79%), Positives = 32/39 (82%) Frame = +1 Query: 4 IGVVWEIDKSPEDVIRVFMMKEFFGTRFFDDLMVHELAR 120 + V DKSPEDVIR FMMKEFFG RFFDDLMVHELAR Sbjct: 155 VSKVLATDKSPEDVIRTFMMKEFFGVRFFDDLMVHELAR 193