BLASTX nr result
ID: Rehmannia31_contig00022650
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00022650 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076903.1| RING-H2 finger protein ATL38 isoform X2 [Ses... 58 2e-07 ref|XP_011076902.1| RING-H2 finger protein ATL38 isoform X1 [Ses... 58 2e-07 ref|XP_012858156.1| PREDICTED: putative RING-H2 finger protein A... 57 8e-07 gb|KZM95773.1| hypothetical protein DCAR_019015 [Daucus carota s... 53 3e-06 gb|PKH67485.1| hypothetical protein CRG98_050158, partial [Punic... 53 4e-06 ref|XP_018853412.1| PREDICTED: RING-H2 finger protein ATL8-like ... 54 6e-06 gb|EEF24747.1| conserved hypothetical protein, partial [Ricinus ... 51 6e-06 ref|XP_022006161.1| RING-H2 finger protein ATL8-like [Helianthus... 54 1e-05 >ref|XP_011076903.1| RING-H2 finger protein ATL38 isoform X2 [Sesamum indicum] Length = 228 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 259 MKSSKINLVMTVIGFGLSIMFIVFVCTRLIC 351 M SS INLVMTVIGFG+SIMFIVFVCTRLIC Sbjct: 1 MMSSGINLVMTVIGFGMSIMFIVFVCTRLIC 31 >ref|XP_011076902.1| RING-H2 finger protein ATL38 isoform X1 [Sesamum indicum] Length = 230 Score = 58.2 bits (139), Expect = 2e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 259 MKSSKINLVMTVIGFGLSIMFIVFVCTRLIC 351 M SS INLVMTVIGFG+SIMFIVFVCTRLIC Sbjct: 1 MMSSGINLVMTVIGFGMSIMFIVFVCTRLIC 31 >ref|XP_012858156.1| PREDICTED: putative RING-H2 finger protein ATL71 [Erythranthe guttata] gb|EYU19797.1| hypothetical protein MIMGU_mgv1a013505mg [Erythranthe guttata] Length = 218 Score = 56.6 bits (135), Expect = 8e-07 Identities = 34/59 (57%), Positives = 35/59 (59%), Gaps = 3/59 (5%) Frame = +1 Query: 259 MKSSKINLVMTVIGFGLSIMFIVFVCTRLIC---XXXXXXXXXXXXXXXXXDLTTMERG 426 M S INLVMTVIGFGLSI FIVFVCTRLIC DLTT+ERG Sbjct: 1 MISPGINLVMTVIGFGLSITFIVFVCTRLICARIHLNASRRFFARAAAAGSDLTTLERG 59 >gb|KZM95773.1| hypothetical protein DCAR_019015 [Daucus carota subsp. sativus] Length = 89 Score = 52.8 bits (125), Expect = 3e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = +1 Query: 259 MKSSKINLVMTVIGFGLSIMFIVFVCTRLIC 351 M SS INLVMTVIGF +S MFIVFVCTRLIC Sbjct: 1 MISSGINLVMTVIGFAVSTMFIVFVCTRLIC 31 >gb|PKH67485.1| hypothetical protein CRG98_050158, partial [Punica granatum] Length = 121 Score = 53.1 bits (126), Expect = 4e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 256 KMKSSKINLVMTVIGFGLSIMFIVFVCTRLIC 351 +M S+ INLVMTVIGF +S MFIVFVCTRLIC Sbjct: 38 RMMSNGINLVMTVIGFAVSTMFIVFVCTRLIC 69 >ref|XP_018853412.1| PREDICTED: RING-H2 finger protein ATL8-like [Juglans regia] Length = 226 Score = 54.3 bits (129), Expect = 6e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 259 MKSSKINLVMTVIGFGLSIMFIVFVCTRLIC 351 M SS INLVMTVIGF +SIMFIVFVCTRL+C Sbjct: 1 MISSGINLVMTVIGFSVSIMFIVFVCTRLVC 31 >gb|EEF24747.1| conserved hypothetical protein, partial [Ricinus communis] Length = 53 Score = 50.8 bits (120), Expect = 6e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +1 Query: 259 MKSSKINLVMTVIGFGLSIMFIVFVCTRLIC 351 M S INLVMTVIGF +S MFIVFVCTRL+C Sbjct: 1 MIGSGINLVMTVIGFAVSTMFIVFVCTRLVC 31 >ref|XP_022006161.1| RING-H2 finger protein ATL8-like [Helianthus annuus] gb|OTF99419.1| putative zinc finger, RING/FYVE/PHD-type [Helianthus annuus] Length = 208 Score = 53.5 bits (127), Expect = 1e-05 Identities = 32/59 (54%), Positives = 33/59 (55%), Gaps = 1/59 (1%) Frame = +1 Query: 259 MKSSKINLVMTVIGFGLSIMFIVFVCTRLIC-XXXXXXXXXXXXXXXXXDLTTMERGFR 432 M S INLVMTVIGF +S MFIVFVCTRLIC DL MERG R Sbjct: 1 MMSPGINLVMTVIGFTVSTMFIVFVCTRLICARIHYISSRRSFRMSSRSDLNAMERGMR 59