BLASTX nr result
ID: Rehmannia31_contig00021967
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021967 (386 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46403.1| hypothetical protein MIMGU_mgv1a012365mg [Erythra... 70 1e-11 ref|XP_012830759.1| PREDICTED: cysteine-rich repeat secretory pr... 70 2e-11 ref|XP_022893185.1| cysteine-rich repeat secretory protein 3-lik... 68 6e-11 ref|XP_012828933.1| PREDICTED: cysteine-rich repeat secretory pr... 68 8e-11 ref|XP_012828932.1| PREDICTED: cysteine-rich repeat secretory pr... 68 8e-11 ref|XP_012828931.1| PREDICTED: cysteine-rich repeat secretory pr... 68 9e-11 gb|EYU17944.1| hypothetical protein MIMGU_mgv1a020216mg [Erythra... 68 9e-11 ref|XP_022874745.1| cysteine-rich repeat secretory protein 3-lik... 67 2e-10 ref|XP_021893781.1| cysteine-rich repeat secretory protein 56 is... 67 2e-10 ref|XP_021893780.1| cysteine-rich repeat secretory protein 56 is... 67 3e-10 ref|XP_008372591.1| PREDICTED: cysteine-rich repeat secretory pr... 66 3e-10 ref|XP_021646224.1| cysteine-rich repeat secretory protein 56 is... 65 4e-10 ref|XP_021646217.1| cysteine-rich repeat secretory protein 56 is... 65 6e-10 ref|XP_021646212.1| cysteine-rich repeat secretory protein 56 is... 65 6e-10 ref|XP_011080110.1| cysteine-rich repeat secretory protein 11-li... 65 6e-10 gb|KJB10029.1| hypothetical protein B456_001G181200 [Gossypium r... 65 6e-10 gb|PPD85031.1| hypothetical protein GOBAR_DD18020 [Gossypium bar... 65 8e-10 ref|XP_012483925.1| PREDICTED: cysteine-rich repeat secretory pr... 65 8e-10 ref|XP_021632158.1| cysteine-rich repeat secretory protein 56 [M... 65 8e-10 gb|PPR97238.1| hypothetical protein GOBAR_AA23431 [Gossypium bar... 65 9e-10 >gb|EYU46403.1| hypothetical protein MIMGU_mgv1a012365mg [Erythranthe guttata] Length = 252 Score = 69.7 bits (169), Expect = 1e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSSS 3 AD TNLVFKGCADQNFQDS G YKQ L NLLDTLI+QSS++ Sbjct: 25 ADNTNLVFKGCADQNFQDSGGTYKQALTNLLDTLITQSSAA 65 >ref|XP_012830759.1| PREDICTED: cysteine-rich repeat secretory protein 3-like [Erythranthe guttata] Length = 296 Score = 69.7 bits (169), Expect = 2e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSSS 3 AD TNLVFKGCADQNFQDS G YKQ L NLLDTLI+QSS++ Sbjct: 25 ADNTNLVFKGCADQNFQDSGGTYKQALTNLLDTLITQSSAA 65 >ref|XP_022893185.1| cysteine-rich repeat secretory protein 3-like [Olea europaea var. sylvestris] Length = 296 Score = 68.2 bits (165), Expect = 6e-11 Identities = 30/41 (73%), Positives = 39/41 (95%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSSS 3 +DYT+LV+KGCA+Q+FQD NGIYKQTL+NL DTLISQ+S++ Sbjct: 25 SDYTDLVYKGCANQDFQDFNGIYKQTLQNLFDTLISQASTA 65 >ref|XP_012828933.1| PREDICTED: cysteine-rich repeat secretory protein 11-like isoform X3 [Erythranthe guttata] Length = 301 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSS 6 ADYTNLVFKGCADQNF D NG+YKQTLK L D L S+SS+ Sbjct: 28 ADYTNLVFKGCADQNFHDFNGLYKQTLKTLFDDLTSKSSA 67 >ref|XP_012828932.1| PREDICTED: cysteine-rich repeat secretory protein 11-like isoform X2 [Erythranthe guttata] Length = 302 Score = 67.8 bits (164), Expect = 8e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSS 6 ADYTNLVFKGCADQNF D NG+YKQTLK L D L S+SS+ Sbjct: 28 ADYTNLVFKGCADQNFHDFNGLYKQTLKTLFDDLTSKSSA 67 >ref|XP_012828931.1| PREDICTED: cysteine-rich repeat secretory protein 11-like isoform X1 [Erythranthe guttata] Length = 304 Score = 67.8 bits (164), Expect = 9e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSS 6 ADYTNLVFKGCADQNF D NG+YKQTLK L D L S+SS+ Sbjct: 28 ADYTNLVFKGCADQNFHDFNGLYKQTLKTLFDDLTSKSSA 67 >gb|EYU17944.1| hypothetical protein MIMGU_mgv1a020216mg [Erythranthe guttata] Length = 313 Score = 67.8 bits (164), Expect = 9e-11 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSS 6 ADYTNLVFKGCADQNF D NG+YKQTLK L D L S+SS+ Sbjct: 28 ADYTNLVFKGCADQNFHDFNGLYKQTLKTLFDDLTSKSSA 67 >ref|XP_022874745.1| cysteine-rich repeat secretory protein 3-like [Olea europaea var. sylvestris] Length = 297 Score = 67.0 bits (162), Expect = 2e-10 Identities = 30/41 (73%), Positives = 38/41 (92%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSSS 3 +DY +LV+KGCA+Q+FQD +GIYKQTLKNL DTLISQSS++ Sbjct: 26 SDYNDLVYKGCANQDFQDFDGIYKQTLKNLFDTLISQSSTT 66 >ref|XP_021893781.1| cysteine-rich repeat secretory protein 56 isoform X2 [Carica papaya] Length = 299 Score = 66.6 bits (161), Expect = 2e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 122 DYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 DYTNLVFKGCADQNFQDS+G+Y Q LK LL +++SQSS Sbjct: 38 DYTNLVFKGCADQNFQDSSGLYSQNLKTLLSSMVSQSS 75 >ref|XP_021893780.1| cysteine-rich repeat secretory protein 56 isoform X1 [Carica papaya] Length = 349 Score = 66.6 bits (161), Expect = 3e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = -1 Query: 122 DYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 DYTNLVFKGCADQNFQDS+G+Y Q LK LL +++SQSS Sbjct: 38 DYTNLVFKGCADQNFQDSSGLYSQNLKTLLSSMVSQSS 75 >ref|XP_008372591.1| PREDICTED: cysteine-rich repeat secretory protein 56 [Malus domestica] Length = 260 Score = 65.9 bits (159), Expect = 3e-10 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 AD TNL++KGCA+QNFQD NG+YKQ LK+L D+L+SQSS Sbjct: 32 ADLTNLIYKGCANQNFQDPNGVYKQNLKSLFDSLVSQSS 70 >ref|XP_021646224.1| cysteine-rich repeat secretory protein 56 isoform X3 [Hevea brasiliensis] Length = 251 Score = 65.5 bits (158), Expect = 4e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCA Q FQD +GIY Q LKNL+++L+SQSS Sbjct: 31 ADYTNLVFKGCAQQKFQDPSGIYSQNLKNLMESLVSQSS 69 >ref|XP_021646217.1| cysteine-rich repeat secretory protein 56 isoform X2 [Hevea brasiliensis] Length = 298 Score = 65.5 bits (158), Expect = 6e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCA Q FQD +GIY Q LKNL+++L+SQSS Sbjct: 31 ADYTNLVFKGCAQQKFQDPSGIYSQNLKNLMESLVSQSS 69 >ref|XP_021646212.1| cysteine-rich repeat secretory protein 56 isoform X1 [Hevea brasiliensis] Length = 300 Score = 65.5 bits (158), Expect = 6e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCA Q FQD +GIY Q LKNL+++L+SQSS Sbjct: 31 ADYTNLVFKGCAQQKFQDPSGIYSQNLKNLMESLVSQSS 69 >ref|XP_011080110.1| cysteine-rich repeat secretory protein 11-like [Sesamum indicum] Length = 300 Score = 65.5 bits (158), Expect = 6e-10 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSSSS 3 +D +NLVFKGCADQNFQD NGIYKQ L+ LLD L+SQSS++ Sbjct: 30 SDDSNLVFKGCADQNFQDFNGIYKQALRGLLDGLVSQSSAA 70 >gb|KJB10029.1| hypothetical protein B456_001G181200 [Gossypium raimondii] Length = 269 Score = 65.1 bits (157), Expect = 6e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCADQ FQD +G+Y Q LKNL+ L+SQSS Sbjct: 32 ADYTNLVFKGCADQKFQDPSGVYLQNLKNLMQDLVSQSS 70 >gb|PPD85031.1| hypothetical protein GOBAR_DD18020 [Gossypium barbadense] Length = 296 Score = 65.1 bits (157), Expect = 8e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCADQ FQD +G+Y Q LKNL+ L+SQSS Sbjct: 32 ADYTNLVFKGCADQKFQDPSGVYLQNLKNLMQDLVSQSS 70 >ref|XP_012483925.1| PREDICTED: cysteine-rich repeat secretory protein 56 [Gossypium raimondii] gb|KJB10030.1| hypothetical protein B456_001G181200 [Gossypium raimondii] Length = 297 Score = 65.1 bits (157), Expect = 8e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCADQ FQD +G+Y Q LKNL+ L+SQSS Sbjct: 32 ADYTNLVFKGCADQKFQDPSGVYLQNLKNLMQDLVSQSS 70 >ref|XP_021632158.1| cysteine-rich repeat secretory protein 56 [Manihot esculenta] gb|OAY32713.1| hypothetical protein MANES_13G040200 [Manihot esculenta] Length = 299 Score = 65.1 bits (157), Expect = 8e-10 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCA+Q FQD +GIY Q L NLL++L+SQSS Sbjct: 31 ADYTNLVFKGCAEQKFQDPSGIYSQNLNNLLESLVSQSS 69 >gb|PPR97238.1| hypothetical protein GOBAR_AA23431 [Gossypium barbadense] Length = 277 Score = 64.7 bits (156), Expect = 9e-10 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = -1 Query: 125 ADYTNLVFKGCADQNFQDSNGIYKQTLKNLLDTLISQSS 9 ADYTNLVFKGCADQ FQD +G+Y Q LKNL+ L+SQSS Sbjct: 32 ADYTNLVFKGCADQKFQDPSGLYLQNLKNLMQDLVSQSS 70