BLASTX nr result
ID: Rehmannia31_contig00021960
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021960 (392 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV23079.1| hypothetical protein F511_26151 [Dorcoceras hygro... 75 4e-14 ref|XP_012847053.1| PREDICTED: uncharacterized proline-rich prot... 75 4e-14 ref|XP_011070503.2| formin-like protein 20 [Sesamum indicum] 75 5e-14 gb|PIN13241.1| Dynamin GTPase [Handroanthus impetiginosus] 69 7e-12 gb|PIN02083.1| hypothetical protein CDL12_25400 [Handroanthus im... 55 7e-07 >gb|KZV23079.1| hypothetical protein F511_26151 [Dorcoceras hygrometricum] Length = 169 Score = 74.7 bits (182), Expect = 4e-14 Identities = 34/49 (69%), Positives = 39/49 (79%) Frame = +3 Query: 246 VYVYNPGTAMPPPGMGQRNFSFPYYYFYASKASCYLPLQEGFILLVVFI 392 VYVYNPG+ MPP GMGQRN + PYYYFYASKAS PLQ+GFI + F+ Sbjct: 116 VYVYNPGSQMPP-GMGQRNVTLPYYYFYASKASSSHPLQQGFIFFIFFV 163 >ref|XP_012847053.1| PREDICTED: uncharacterized proline-rich protein [Erythranthe guttata] Length = 179 Score = 74.7 bits (182), Expect = 4e-14 Identities = 35/50 (70%), Positives = 43/50 (86%), Gaps = 1/50 (2%) Frame = +3 Query: 246 VYVYNPGTAMPPPGMGQRNFSFPYYYFYASKASCYL-PLQEGFILLVVFI 392 VYVYNPGT +PP MGQ+N+S+PYYYFY S+ASCY+ PL+ GFILL +FI Sbjct: 125 VYVYNPGTTVPPV-MGQQNYSYPYYYFYTSEASCYVRPLRWGFILLFLFI 173 >ref|XP_011070503.2| formin-like protein 20 [Sesamum indicum] Length = 198 Score = 75.1 bits (183), Expect = 5e-14 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 1/50 (2%) Frame = +3 Query: 246 VYVYNPGTAMPPPGMGQRNFSFPYYYFYASKASCYLP-LQEGFILLVVFI 392 VYVYNPGT MPP GMGQRN+S+PYYYFYASKA LP L +G ILL++FI Sbjct: 144 VYVYNPGTIMPP-GMGQRNYSYPYYYFYASKAVSSLPLLDQGLILLMLFI 192 >gb|PIN13241.1| Dynamin GTPase [Handroanthus impetiginosus] Length = 192 Score = 69.3 bits (168), Expect = 7e-12 Identities = 34/49 (69%), Positives = 36/49 (73%) Frame = +3 Query: 246 VYVYNPGTAMPPPGMGQRNFSFPYYYFYASKASCYLPLQEGFILLVVFI 392 VY YNPG MGQRNFS+PYYYFYASKASCYLP + IL VVFI Sbjct: 144 VYGYNPGN------MGQRNFSYPYYYFYASKASCYLPFHQAPILSVVFI 186 >gb|PIN02083.1| hypothetical protein CDL12_25400 [Handroanthus impetiginosus] gb|PIN21551.1| hypothetical protein CDL12_05761 [Handroanthus impetiginosus] Length = 142 Score = 55.1 bits (131), Expect = 7e-07 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = +3 Query: 246 VYVYNPGTAMPPPGMGQRNFSFPYYYFYASKASCYLPLQEGFILL 380 +YVYNPGT Q+NFS+PYYYFY+SKA+C +PL +GFI L Sbjct: 92 LYVYNPGTM-------QQNFSYPYYYFYSSKATCSVPL-DGFINL 128