BLASTX nr result
ID: Rehmannia31_contig00021932
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021932 (596 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083296.1| regulator of nonsense transcripts UPF2 isofo... 130 2e-31 ref|XP_011083289.1| regulator of nonsense transcripts UPF2 isofo... 130 2e-31 ref|XP_012852701.1| PREDICTED: regulator of nonsense transcripts... 122 2e-28 gb|EYU24490.1| hypothetical protein MIMGU_mgv1a000416mg [Erythra... 122 2e-28 ref|XP_012852700.1| PREDICTED: regulator of nonsense transcripts... 122 2e-28 gb|PLY68920.1| hypothetical protein LSAT_2X116140 [Lactuca sativa] 104 5e-25 ref|XP_009778348.1| PREDICTED: regulator of nonsense transcripts... 112 5e-25 ref|XP_019231908.1| PREDICTED: regulator of nonsense transcripts... 112 5e-25 gb|OIT28399.1| regulator of nonsense transcripts upf2 [Nicotiana... 112 5e-25 gb|KZV46480.1| hypothetical protein F511_10585 [Dorcoceras hygro... 110 1e-24 ref|XP_022890132.1| regulator of nonsense transcripts UPF2 [Olea... 110 2e-24 ref|XP_016440625.1| PREDICTED: regulator of nonsense transcripts... 110 2e-24 ref|XP_009601343.1| PREDICTED: regulator of nonsense transcripts... 110 2e-24 gb|PHU03550.1| Regulator of nonsense transcripts UPF2 [Capsicum ... 110 2e-24 gb|PHT34922.1| Regulator of nonsense transcripts UPF2 [Capsicum ... 110 2e-24 ref|XP_010319853.1| PREDICTED: regulator of nonsense transcripts... 109 3e-24 ref|XP_010319848.1| PREDICTED: regulator of nonsense transcripts... 109 3e-24 ref|XP_015073456.1| PREDICTED: regulator of nonsense transcripts... 109 5e-24 ref|XP_021973766.1| regulator of nonsense transcripts UPF2-like ... 108 9e-24 ref|XP_021973761.1| regulator of nonsense transcripts UPF2-like ... 108 9e-24 >ref|XP_011083296.1| regulator of nonsense transcripts UPF2 isoform X2 [Sesamum indicum] Length = 1185 Score = 130 bits (327), Expect = 2e-31 Identities = 65/86 (75%), Positives = 68/86 (79%), Gaps = 1/86 (1%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQSGGRVANRGHTWD 415 SLVQ T QDIKRLVLEYNDREEEELNGG +QPLNWTQSGGRV NRGHTWD Sbjct: 1101 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGG-TQPLNWTQSGGRVTNRGHTWD 1159 Query: 414 GHGRA-GPRHRHLYHSGAGFYYGRRR 340 GH R+ G RHRH+YHSGAG YYGRRR Sbjct: 1160 GHNRSGGSRHRHIYHSGAGVYYGRRR 1185 >ref|XP_011083289.1| regulator of nonsense transcripts UPF2 isoform X1 [Sesamum indicum] Length = 1189 Score = 130 bits (327), Expect = 2e-31 Identities = 65/86 (75%), Positives = 68/86 (79%), Gaps = 1/86 (1%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQSGGRVANRGHTWD 415 SLVQ T QDIKRLVLEYNDREEEELNGG +QPLNWTQSGGRV NRGHTWD Sbjct: 1105 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGG-TQPLNWTQSGGRVTNRGHTWD 1163 Query: 414 GHGRA-GPRHRHLYHSGAGFYYGRRR 340 GH R+ G RHRH+YHSGAG YYGRRR Sbjct: 1164 GHNRSGGSRHRHIYHSGAGVYYGRRR 1189 >ref|XP_012852701.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X2 [Erythranthe guttata] Length = 1088 Score = 122 bits (305), Expect = 2e-28 Identities = 61/87 (70%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQSGGRVANRGHTWD 415 SLVQ T QDIKRLVLEYNDREEEELNGGGSQP +WTQSGGRV+N TWD Sbjct: 1002 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGGGSQPSSWTQSGGRVSNTRPTWD 1061 Query: 414 GHGR--AGPRHRHLYHSGAGFYYGRRR 340 G R G RHRH+YHSGAG YYGRRR Sbjct: 1062 GQSRTSGGSRHRHIYHSGAGIYYGRRR 1088 >gb|EYU24490.1| hypothetical protein MIMGU_mgv1a000416mg [Erythranthe guttata] Length = 1169 Score = 122 bits (305), Expect = 2e-28 Identities = 61/87 (70%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQSGGRVANRGHTWD 415 SLVQ T QDIKRLVLEYNDREEEELNGGGSQP +WTQSGGRV+N TWD Sbjct: 1083 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGGGSQPSSWTQSGGRVSNTRPTWD 1142 Query: 414 GHGR--AGPRHRHLYHSGAGFYYGRRR 340 G R G RHRH+YHSGAG YYGRRR Sbjct: 1143 GQSRTSGGSRHRHIYHSGAGIYYGRRR 1169 >ref|XP_012852700.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Erythranthe guttata] Length = 1190 Score = 122 bits (305), Expect = 2e-28 Identities = 61/87 (70%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQSGGRVANRGHTWD 415 SLVQ T QDIKRLVLEYNDREEEELNGGGSQP +WTQSGGRV+N TWD Sbjct: 1104 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGGGSQPSSWTQSGGRVSNTRPTWD 1163 Query: 414 GHGR--AGPRHRHLYHSGAGFYYGRRR 340 G R G RHRH+YHSGAG YYGRRR Sbjct: 1164 GQSRTSGGSRHRHIYHSGAGIYYGRRR 1190 >gb|PLY68920.1| hypothetical protein LSAT_2X116140 [Lactuca sativa] Length = 146 Score = 104 bits (259), Expect = 5e-25 Identities = 52/87 (59%), Positives = 63/87 (72%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQS-GGRVANRGHTW 418 SLVQ T QDIKRLVLEYNDREEEELN G+ P+ W+QS GGRV RGH+W Sbjct: 60 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNALGNLPVGWSQSGGGRVVYRGHSW 119 Query: 417 DGH-GRAGPRHRHLYHSGAGFYYGRRR 340 +GH GR+G RHR+ +H+G G+YY RR+ Sbjct: 120 EGHGGRSGSRHRYPHHTGGGYYYSRRK 146 >ref|XP_009778348.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana sylvestris] ref|XP_009778349.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana sylvestris] ref|XP_016515866.1| PREDICTED: regulator of nonsense transcripts UPF2-like [Nicotiana tabacum] ref|XP_016515867.1| PREDICTED: regulator of nonsense transcripts UPF2-like [Nicotiana tabacum] ref|XP_016515869.1| PREDICTED: regulator of nonsense transcripts UPF2-like [Nicotiana tabacum] Length = 1191 Score = 112 bits (279), Expect = 5e-25 Identities = 58/87 (66%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG+TW Sbjct: 1105 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQNSGSRVAHRGNTW 1164 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+LYHSG G YYGRRR Sbjct: 1165 DAPGRGSGSRHRYLYHSGGGLYYGRRR 1191 >ref|XP_019231908.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana attenuata] ref|XP_019231910.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana attenuata] Length = 1196 Score = 112 bits (279), Expect = 5e-25 Identities = 58/87 (66%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG+TW Sbjct: 1110 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQNSGSRVAHRGNTW 1169 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+LYHSG G YYGRRR Sbjct: 1170 DAPGRGSGSRHRYLYHSGGGLYYGRRR 1196 >gb|OIT28399.1| regulator of nonsense transcripts upf2 [Nicotiana attenuata] Length = 1200 Score = 112 bits (279), Expect = 5e-25 Identities = 58/87 (66%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG+TW Sbjct: 1114 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQNSGSRVAHRGNTW 1173 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+LYHSG G YYGRRR Sbjct: 1174 DAPGRGSGSRHRYLYHSGGGLYYGRRR 1200 >gb|KZV46480.1| hypothetical protein F511_10585 [Dorcoceras hygrometricum] Length = 1173 Score = 110 bits (276), Expect = 1e-24 Identities = 60/86 (69%), Positives = 63/86 (73%), Gaps = 1/86 (1%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQSGGRVANRGHTWD 415 SLVQGT QDIKRLVLEYNDREEEELN GG+QP + T SGGRV NRGH D Sbjct: 1089 SLVQGTKQKEAAELEEKQDIKRLVLEYNDREEEELN-GGTQPPSLTLSGGRVVNRGHMLD 1147 Query: 414 GHGR-AGPRHRHLYHSGAGFYYGRRR 340 G R +G RHRHLYHSGAG YYGRRR Sbjct: 1148 GQNRTSGSRHRHLYHSGAGVYYGRRR 1173 >ref|XP_022890132.1| regulator of nonsense transcripts UPF2 [Olea europaea var. sylvestris] Length = 1184 Score = 110 bits (275), Expect = 2e-24 Identities = 58/86 (67%), Positives = 63/86 (73%), Gaps = 2/86 (2%) Frame = -3 Query: 591 LVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQSGG-RVANRGHTWD 415 LVQ T QDIKR VLEYNDREEEEL+GG +QP WT SGG RV NRGHTW+ Sbjct: 1100 LVQSTKQKEAAELEEKQDIKRRVLEYNDREEEELSGG-TQPSGWTPSGGGRVVNRGHTWE 1158 Query: 414 GHGRA-GPRHRHLYHSGAGFYYGRRR 340 GHGRA G RHR+LYHSG G YYGRR+ Sbjct: 1159 GHGRASGSRHRNLYHSGGGHYYGRRK 1184 >ref|XP_016440625.1| PREDICTED: regulator of nonsense transcripts UPF2-like [Nicotiana tabacum] ref|XP_016440626.1| PREDICTED: regulator of nonsense transcripts UPF2-like [Nicotiana tabacum] Length = 1193 Score = 110 bits (274), Expect = 2e-24 Identities = 57/87 (65%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG+ W Sbjct: 1107 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQNSGSRVAHRGNAW 1166 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+LYHSG G YYGRRR Sbjct: 1167 DAPGRGSGSRHRYLYHSGGGLYYGRRR 1193 >ref|XP_009601343.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana tomentosiformis] ref|XP_009601344.1| PREDICTED: regulator of nonsense transcripts UPF2 [Nicotiana tomentosiformis] Length = 1195 Score = 110 bits (274), Expect = 2e-24 Identities = 57/87 (65%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG+ W Sbjct: 1109 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQNSGSRVAHRGNAW 1168 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+LYHSG G YYGRRR Sbjct: 1169 DAPGRGSGSRHRYLYHSGGGLYYGRRR 1195 >gb|PHU03550.1| Regulator of nonsense transcripts UPF2 [Capsicum chinense] Length = 1202 Score = 110 bits (274), Expect = 2e-24 Identities = 57/87 (65%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG+TW Sbjct: 1116 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQSSGSRVAHRGNTW 1175 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+L+HSG G YYGRRR Sbjct: 1176 DAPGRGSGSRHRYLHHSGGGLYYGRRR 1202 >gb|PHT34922.1| Regulator of nonsense transcripts UPF2 [Capsicum baccatum] Length = 1202 Score = 110 bits (274), Expect = 2e-24 Identities = 57/87 (65%), Positives = 65/87 (74%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG+TW Sbjct: 1116 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQSSGSRVAHRGNTW 1175 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+L+HSG G YYGRRR Sbjct: 1176 DAPGRGSGSRHRYLHHSGGGLYYGRRR 1202 >ref|XP_010319853.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X2 [Solanum lycopersicum] Length = 1125 Score = 109 bits (273), Expect = 3e-24 Identities = 57/87 (65%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG TW Sbjct: 1039 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPSSWTQSSGSRVAHRGSTW 1098 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+L+HSG G YYGRRR Sbjct: 1099 DAPGRGSGSRHRYLHHSGGGLYYGRRR 1125 >ref|XP_010319848.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] ref|XP_010319849.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] ref|XP_010319850.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] ref|XP_010319851.1| PREDICTED: regulator of nonsense transcripts UPF2 isoform X1 [Solanum lycopersicum] Length = 1198 Score = 109 bits (273), Expect = 3e-24 Identities = 57/87 (65%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG TW Sbjct: 1112 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPSSWTQSSGSRVAHRGSTW 1171 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+L+HSG G YYGRRR Sbjct: 1172 DAPGRGSGSRHRYLHHSGGGLYYGRRR 1198 >ref|XP_015073456.1| PREDICTED: regulator of nonsense transcripts UPF2 [Solanum pennellii] ref|XP_015073457.1| PREDICTED: regulator of nonsense transcripts UPF2 [Solanum pennellii] Length = 1198 Score = 109 bits (272), Expect = 5e-24 Identities = 57/87 (65%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQ-SGGRVANRGHTW 418 SL+Q T QDIKRLVLEYNDREEEELNG G+QP +WTQ SG RVA+RG TW Sbjct: 1112 SLIQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNGLGNQPPSWTQSSGSRVAHRGSTW 1171 Query: 417 DGHGR-AGPRHRHLYHSGAGFYYGRRR 340 D GR +G RHR+L+HSG G YYGRRR Sbjct: 1172 DAPGRGSGSRHRYLHHSGGGLYYGRRR 1198 >ref|XP_021973766.1| regulator of nonsense transcripts UPF2-like isoform X2 [Helianthus annuus] gb|OTG21144.1| putative RNA binding protein [Helianthus annuus] Length = 1178 Score = 108 bits (270), Expect = 9e-24 Identities = 55/87 (63%), Positives = 63/87 (72%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQS-GGRVANRGHTW 418 SLVQ T QDIKRLVLEYNDREEEELN G+ P+ W+QS GGRV RGHTW Sbjct: 1092 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNALGNLPVGWSQSGGGRVVYRGHTW 1151 Query: 417 DGH-GRAGPRHRHLYHSGAGFYYGRRR 340 DGH GR+G RHR+ +HSG G+YY RR+ Sbjct: 1152 DGHGGRSGSRHRYPHHSGGGYYYSRRK 1178 >ref|XP_021973761.1| regulator of nonsense transcripts UPF2-like isoform X1 [Helianthus annuus] ref|XP_021973762.1| regulator of nonsense transcripts UPF2-like isoform X1 [Helianthus annuus] ref|XP_021973763.1| regulator of nonsense transcripts UPF2-like isoform X1 [Helianthus annuus] ref|XP_021973764.1| regulator of nonsense transcripts UPF2-like isoform X1 [Helianthus annuus] ref|XP_021973765.1| regulator of nonsense transcripts UPF2-like isoform X1 [Helianthus annuus] Length = 1184 Score = 108 bits (270), Expect = 9e-24 Identities = 55/87 (63%), Positives = 63/87 (72%), Gaps = 2/87 (2%) Frame = -3 Query: 594 SLVQGTXXXXXXXXXXXQDIKRLVLEYNDREEEELNGGGSQPLNWTQS-GGRVANRGHTW 418 SLVQ T QDIKRLVLEYNDREEEELN G+ P+ W+QS GGRV RGHTW Sbjct: 1098 SLVQSTKQKEAAELEEKQDIKRLVLEYNDREEEELNALGNLPVGWSQSGGGRVVYRGHTW 1157 Query: 417 DGH-GRAGPRHRHLYHSGAGFYYGRRR 340 DGH GR+G RHR+ +HSG G+YY RR+ Sbjct: 1158 DGHGGRSGSRHRYPHHSGGGYYYSRRK 1184