BLASTX nr result
ID: Rehmannia31_contig00021907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021907 (393 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011092328.1| uncharacterized zinc finger protein At4g0663... 59 2e-07 >ref|XP_011092328.1| uncharacterized zinc finger protein At4g06634 [Sesamum indicum] Length = 371 Score = 58.5 bits (140), Expect = 2e-07 Identities = 29/51 (56%), Positives = 30/51 (58%) Frame = -3 Query: 334 QRKSSIAPAGNLNVVKKPWPSKXXXXXXXXXXXXXXXXDNVGEGWRYGENN 182 QRKSS A NLNVVKKPWP K DNVG+GWRYGENN Sbjct: 310 QRKSSAASVANLNVVKKPWPLKEEVYEEEDSEETEEERDNVGDGWRYGENN 360