BLASTX nr result
ID: Rehmannia31_contig00021847
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021847 (571 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_016497894.1| PREDICTED: uncharacterized protein LOC107816... 84 2e-18 ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590... 82 9e-18 ref|XP_009802820.1| PREDICTED: uncharacterized protein LOC104248... 82 1e-17 gb|OAY52326.1| hypothetical protein MANES_04G074200 [Manihot esc... 79 3e-16 gb|OAY37235.1| hypothetical protein MANES_11G084900 [Manihot esc... 78 5e-16 ref|XP_009782352.1| PREDICTED: uncharacterized protein LOC104231... 78 5e-16 ref|XP_015055129.1| PREDICTED: uncharacterized protein LOC107001... 77 8e-16 ref|XP_015570959.1| PREDICTED: uncharacterized protein LOC107260... 77 1e-15 ref|XP_016461802.1| PREDICTED: uncharacterized protein LOC107785... 75 9e-15 gb|PIN14039.1| hypothetical protein CDL12_13336 [Handroanthus im... 74 1e-14 ref|XP_017971848.1| PREDICTED: uncharacterized protein LOC108660... 74 2e-14 ref|XP_015868829.1| PREDICTED: uncharacterized protein LOC107406... 74 2e-14 ref|XP_012458859.1| PREDICTED: uncharacterized protein LOC105779... 74 2e-14 ref|XP_011047973.1| PREDICTED: uncharacterized protein LOC105142... 74 2e-14 ref|XP_012480365.1| PREDICTED: uncharacterized protein LOC105795... 73 3e-14 ref|XP_011037477.1| PREDICTED: uncharacterized protein LOC105134... 73 5e-14 ref|XP_007131799.1| hypothetical protein PHAVU_011G042700g [Phas... 72 7e-14 ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488... 72 7e-14 ref|XP_017232105.1| PREDICTED: uncharacterized protein LOC108206... 72 7e-14 ref|XP_012836817.1| PREDICTED: uncharacterized protein LOC105957... 72 1e-13 >ref|XP_016497894.1| PREDICTED: uncharacterized protein LOC107816674 [Nicotiana tabacum] gb|PIN15171.1| hypothetical protein CDL12_12183 [Handroanthus impetiginosus] Length = 41 Score = 84.0 bits (206), Expect = 2e-18 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MSAILSELF SGFMINSTYRRRTHLVQSFSVVFLYWFYYIS Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 41 >ref|XP_006362036.1| PREDICTED: uncharacterized protein LOC102590957 [Solanum tuberosum] ref|XP_015058155.1| PREDICTED: uncharacterized protein LOC107004438 [Solanum pennellii] ref|XP_016539774.1| PREDICTED: uncharacterized protein LOC107840430 [Capsicum annuum] gb|PHT59094.1| hypothetical protein CQW23_01457 [Capsicum baccatum] gb|PHT61932.1| hypothetical protein T459_34201 [Capsicum annuum] gb|PHU10636.1| hypothetical protein BC332_22496 [Capsicum chinense] Length = 41 Score = 82.4 bits (202), Expect = 9e-18 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MSAILSELF SGFMINSTYRRRTHLVQSFSVVFLYWFY+IS Sbjct: 1 MSAILSELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYFIS 41 >ref|XP_009802820.1| PREDICTED: uncharacterized protein LOC104248286 [Nicotiana sylvestris] ref|XP_016440542.1| PREDICTED: uncharacterized protein LOC107766297 [Nicotiana tabacum] Length = 41 Score = 82.0 bits (201), Expect = 1e-17 Identities = 39/41 (95%), Positives = 39/41 (95%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MSAILSELF SGFMINSTYRRR HLVQSFSVVFLYWFYYIS Sbjct: 1 MSAILSELFLSGFMINSTYRRRAHLVQSFSVVFLYWFYYIS 41 >gb|OAY52326.1| hypothetical protein MANES_04G074200 [Manihot esculenta] Length = 41 Score = 78.6 bits (192), Expect = 3e-16 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSE+F SGFMINSTYRRRTHLVQSFSVVFLYW YY+S Sbjct: 1 MSPILSEIFLSGFMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >gb|OAY37235.1| hypothetical protein MANES_11G084900 [Manihot esculenta] Length = 41 Score = 77.8 bits (190), Expect = 5e-16 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS I+SE+F SGFMINSTYRRRTHLVQSFSVVFLYW YY+S Sbjct: 1 MSPIISEIFLSGFMINSTYRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_009782352.1| PREDICTED: uncharacterized protein LOC104231113 [Nicotiana sylvestris] ref|XP_016471890.1| PREDICTED: uncharacterized protein LOC107793952 [Nicotiana tabacum] Length = 41 Score = 77.8 bits (190), Expect = 5e-16 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS IL+ELF SGFMINSTYRRRTHLVQSFSVVFLYWFY IS Sbjct: 1 MSTILTELFLSGFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >ref|XP_015055129.1| PREDICTED: uncharacterized protein LOC107001685 [Solanum pennellii] Length = 41 Score = 77.4 bits (189), Expect = 8e-16 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MSAIL+ELF GFMINSTYRRRTHLVQSFSVVFLYWFY IS Sbjct: 1 MSAILNELFLCGFMINSTYRRRTHLVQSFSVVFLYWFYCIS 41 >ref|XP_015570959.1| PREDICTED: uncharacterized protein LOC107260797 [Ricinus communis] Length = 41 Score = 77.0 bits (188), Expect = 1e-15 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSELFFSG MINST+RRRTHLVQSFSVVFLYW YY+S Sbjct: 1 MSPILSELFFSGCMINSTFRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_016461802.1| PREDICTED: uncharacterized protein LOC107785091 [Nicotiana tabacum] Length = 41 Score = 74.7 bits (182), Expect = 9e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MSAIL+EL SGFMIN TYRRRTHLVQSFSVVFLYWFY IS Sbjct: 1 MSAILTELLLSGFMINFTYRRRTHLVQSFSVVFLYWFYCIS 41 >gb|PIN14039.1| hypothetical protein CDL12_13336 [Handroanthus impetiginosus] Length = 41 Score = 74.3 bits (181), Expect = 1e-14 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSE+F SGFMINS+Y +RTHL+QSFSVVFLYWFYYIS Sbjct: 1 MSVILSEIFLSGFMINSSYIQRTHLLQSFSVVFLYWFYYIS 41 >ref|XP_017971848.1| PREDICTED: uncharacterized protein LOC108660980 [Theobroma cacao] Length = 41 Score = 73.9 bits (180), Expect = 2e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSE+F SGFMINST+ RRTHLVQSFSVVFLYW YY+S Sbjct: 1 MSPILSEIFLSGFMINSTFIRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_015868829.1| PREDICTED: uncharacterized protein LOC107406238 [Ziziphus jujuba] Length = 41 Score = 73.9 bits (180), Expect = 2e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSE+F SG MINST+RRRTHLVQSFSVVFLYW YY+S Sbjct: 1 MSPILSEIFLSGCMINSTFRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_012458859.1| PREDICTED: uncharacterized protein LOC105779590 [Gossypium raimondii] ref|XP_016679558.1| PREDICTED: uncharacterized protein LOC107898568 [Gossypium hirsutum] ref|XP_016739307.1| PREDICTED: uncharacterized protein LOC107949101 [Gossypium hirsutum] ref|XP_017615625.1| PREDICTED: uncharacterized protein LOC108460590 [Gossypium arboreum] Length = 41 Score = 73.9 bits (180), Expect = 2e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 M ILSE+FFSGFMINST+ RRTHLVQSFSVVFLYW YY+S Sbjct: 1 MFPILSEIFFSGFMINSTFIRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_011047973.1| PREDICTED: uncharacterized protein LOC105142160 [Populus euphratica] Length = 41 Score = 73.9 bits (180), Expect = 2e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSE+F SG MINST+RRRTHLVQSFSVVFLYW YY+S Sbjct: 1 MSPILSEIFISGCMINSTFRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_012480365.1| PREDICTED: uncharacterized protein LOC105795331 [Gossypium raimondii] ref|XP_016691562.1| PREDICTED: uncharacterized protein LOC107908800 [Gossypium hirsutum] ref|XP_017632083.1| PREDICTED: uncharacterized protein LOC108474614 [Gossypium arboreum] Length = 41 Score = 73.2 bits (178), Expect = 3e-14 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSE+FFSGFMINST+ RRT LVQSFSVVFLYW YY+S Sbjct: 1 MSPILSEIFFSGFMINSTFIRRTQLVQSFSVVFLYWLYYVS 41 >ref|XP_011037477.1| PREDICTED: uncharacterized protein LOC105134676 [Populus euphratica] Length = 41 Score = 72.8 bits (177), Expect = 5e-14 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 MS ILSE+F +G MINST+RRRTHLVQSFSVVFLYW YY+S Sbjct: 1 MSPILSEIFITGCMINSTFRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_007131799.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] ref|XP_017433874.1| PREDICTED: uncharacterized protein LOC108340802 [Vigna angularis] gb|ESW03793.1| hypothetical protein PHAVU_011G042700g [Phaseolus vulgaris] Length = 41 Score = 72.4 bits (176), Expect = 7e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 M +ILSELFFSG MINST RRRTHLVQSFSV FLYW YY+S Sbjct: 1 MYSILSELFFSGCMINSTVRRRTHLVQSFSVAFLYWLYYVS 41 >ref|XP_004500792.1| PREDICTED: uncharacterized protein LOC101488322 [Cicer arietinum] Length = 41 Score = 72.4 bits (176), Expect = 7e-14 Identities = 34/41 (82%), Positives = 36/41 (87%) Frame = +2 Query: 176 MSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 M ILSE+FFSG MINST RRRTHLVQSFSVVFLYW YY+S Sbjct: 1 MYQILSEIFFSGCMINSTVRRRTHLVQSFSVVFLYWLYYVS 41 >ref|XP_017232105.1| PREDICTED: uncharacterized protein LOC108206349 [Daucus carota subsp. sativus] Length = 44 Score = 72.4 bits (176), Expect = 7e-14 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = +2 Query: 167 LRFMSAILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFYYIS 298 ++ MS ILSELF GFMINS Y+RRTHLV SFSVVFLYW Y++S Sbjct: 1 MKLMSQILSELFLCGFMINSVYKRRTHLVSSFSVVFLYWLYFVS 44 >ref|XP_012836817.1| PREDICTED: uncharacterized protein LOC105957442 [Erythranthe guttata] Length = 43 Score = 72.0 bits (175), Expect = 1e-13 Identities = 37/43 (86%), Positives = 40/43 (93%), Gaps = 2/43 (4%) Frame = +2 Query: 176 MSA-ILSELFFSGFMINSTYRRRTHLVQSFSVVFLYWFY-YIS 298 MSA IL+ELF SGFM+NSTY+RRTHLVQSFSVVFLYWFY YIS Sbjct: 1 MSALILTELFLSGFMVNSTYKRRTHLVQSFSVVFLYWFYNYIS 43