BLASTX nr result
ID: Rehmannia31_contig00021796
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021796 (501 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827339.1| PREDICTED: deSI-like protein At4g17486 [Eryt... 58 4e-07 >ref|XP_012827339.1| PREDICTED: deSI-like protein At4g17486 [Erythranthe guttata] gb|EYU19272.1| hypothetical protein MIMGU_mgv1a013313mg [Erythranthe guttata] Length = 224 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 94 MKLFPISSSLDSSPAEQNNTEKSHAMLYLNV 2 M+LFP+SSSLDSSP EQNNTEKS AMLYLNV Sbjct: 1 MRLFPVSSSLDSSPTEQNNTEKSQAMLYLNV 31