BLASTX nr result
ID: Rehmannia31_contig00021704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021704 (752 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17654.1| hypothetical protein CDL12_09687 [Handroanthus im... 73 3e-12 >gb|PIN17654.1| hypothetical protein CDL12_09687 [Handroanthus impetiginosus] Length = 170 Score = 73.2 bits (178), Expect = 3e-12 Identities = 33/58 (56%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = -2 Query: 370 LPQMPFCNPPKNPHLHHQLHCLSKQLCFVYFFSRIMWAFS---GSEFFFSQRKQESKE 206 LPQMPFCNPPK+PHLHHQLHCLS+QLCF YF + F+ G +F F + +++K+ Sbjct: 46 LPQMPFCNPPKDPHLHHQLHCLSQQLCF-YFCPNYVGFFALCLGQKFIFHRENRKAKK 102