BLASTX nr result
ID: Rehmannia31_contig00021534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021534 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN13892.1| K+-channel ERG [Handroanthus impetiginosus] 88 2e-17 ref|XP_020553229.1| cyclic nucleotide-gated ion channel 1 [Sesam... 79 2e-14 ref|XP_022871445.1| cyclic nucleotide-gated ion channel 1-like [... 62 1e-08 ref|XP_006345559.1| PREDICTED: cyclic nucleotide-gated ion chann... 59 2e-07 ref|XP_016510636.1| PREDICTED: cyclic nucleotide-gated ion chann... 59 3e-07 ref|XP_004306680.1| PREDICTED: cyclic nucleotide-gated ion chann... 58 6e-07 ref|XP_010321517.1| PREDICTED: cyclic nucleotide-gated ion chann... 57 1e-06 ref|XP_004240079.1| PREDICTED: cyclic nucleotide-gated ion chann... 57 1e-06 emb|CDP08690.1| unnamed protein product [Coffea canephora] 56 2e-06 ref|XP_015074516.1| PREDICTED: cyclic nucleotide-gated ion chann... 56 2e-06 gb|PHU17855.1| Cyclic nucleotide-gated ion channel 1 [Capsicum c... 55 4e-06 ref|XP_011038085.1| PREDICTED: cyclic nucleotide-gated ion chann... 55 5e-06 gb|PRQ58437.1| putative potassium channel, voltage-dependent, EA... 55 7e-06 gb|PNT03954.1| hypothetical protein POPTR_014G097900v3 [Populus ... 55 7e-06 ref|XP_016580009.1| PREDICTED: cyclic nucleotide-gated ion chann... 55 7e-06 ref|XP_002320197.2| hypothetical protein POPTR_0014s09350g [Popu... 55 7e-06 ref|XP_024176142.1| cyclic nucleotide-gated ion channel 1-like [... 55 7e-06 >gb|PIN13892.1| K+-channel ERG [Handroanthus impetiginosus] Length = 714 Score = 87.8 bits (216), Expect = 2e-17 Identities = 44/68 (64%), Positives = 49/68 (72%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSRNRRLNIPLRKPNLSSIMGGIRRGVDRGSERIKSF 29 MN NG+KYVRF+DC+SE SFS NRRL PL NLSSIMG IRR D SERIKS Sbjct: 1 MNFNGDKYVRFDDCNSENSFSSKGQSNRRL-FPLTSSNLSSIMGRIRRRFDMSSERIKSL 59 Query: 28 RNWSLHGH 5 R W+L+GH Sbjct: 60 RRWNLNGH 67 >ref|XP_020553229.1| cyclic nucleotide-gated ion channel 1 [Sesamum indicum] Length = 717 Score = 79.0 bits (193), Expect = 2e-14 Identities = 42/69 (60%), Positives = 50/69 (72%), Gaps = 1/69 (1%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSRNRRLNIPLRKPNLSSIMGGIRRGVDRGSERIKSF 29 MNI+G+KYVRF+DC+SE SFS + NR L PLRKPN I+GGIRR DR SERIK+ Sbjct: 1 MNISGKKYVRFKDCNSESSFSSEGQSNRGL-FPLRKPNFRPIVGGIRRAFDRSSERIKNL 59 Query: 28 RNWSLH-GH 5 R S+ GH Sbjct: 60 RIRSIDWGH 68 >ref|XP_022871445.1| cyclic nucleotide-gated ion channel 1-like [Olea europaea var. sylvestris] Length = 709 Score = 62.4 bits (150), Expect = 1e-08 Identities = 35/68 (51%), Positives = 42/68 (61%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSRNRRLNIPLRKPNLSSIMGGIRRGVDRGSERIKSF 29 M I KYVRFE+ +SE SFS + N P PNLSS+M G+RRG + GS R+KS Sbjct: 1 MKIKPRKYVRFEESNSETSFSPEQHSNS-WQFPKWNPNLSSVMSGVRRGFEIGSSRMKSL 59 Query: 28 RNWSLHGH 5 R SLH H Sbjct: 60 RK-SLHSH 66 >ref|XP_006345559.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum tuberosum] ref|XP_006345560.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum tuberosum] ref|XP_015163420.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum tuberosum] Length = 723 Score = 58.9 bits (141), Expect = 2e-07 Identities = 35/64 (54%), Positives = 46/64 (71%), Gaps = 3/64 (4%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKS-FSFDSSRNRRLNIP--LRKPNLSSIMGGIRRGVDRGSERI 38 MN N +KYVRFED SE+S FS D+ N + N P +RKP+LSS+M ++R +RGSERI Sbjct: 2 MNPNQDKYVRFEDWKSEQSSFSIDNE-NSQDNRPFYVRKPSLSSLMSSVKRRFERGSERI 60 Query: 37 KSFR 26 S+R Sbjct: 61 SSWR 64 >ref|XP_016510636.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana tabacum] ref|XP_018625693.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Nicotiana tomentosiformis] Length = 717 Score = 58.5 bits (140), Expect = 3e-07 Identities = 33/61 (54%), Positives = 43/61 (70%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSRNRRLNIPLRKPNLSSIMGGIRRGVDRGSERIKSF 29 MN+ +KYVRFED SE+S SF+S NR +I RKP+ S +M IRR ++ GSERI S+ Sbjct: 2 MNLKQDKYVRFEDWKSEES-SFNSPNNRPFHI--RKPSFSLLMSNIRRRLESGSERISSW 58 Query: 28 R 26 R Sbjct: 59 R 59 >ref|XP_004306680.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Fragaria vesca subsp. vesca] Length = 719 Score = 57.8 bits (138), Expect = 6e-07 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 6/67 (8%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKS------FSFDSSRNRRLNIPLRKPNLSSIMGGIRRGVDRGS 47 MN+ G K+VRF+D SE+S FS D RNRR +P+L++++ IRRG DRGS Sbjct: 1 MNLKGTKFVRFDDWRSERSTSSEREFSTDDGRNRRRP----RPSLNAVLSSIRRGFDRGS 56 Query: 46 ERIKSFR 26 +R K+ R Sbjct: 57 DRFKTLR 63 >ref|XP_010321517.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X3 [Solanum lycopersicum] Length = 648 Score = 57.0 bits (136), Expect = 1e-06 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 3/64 (4%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKS-FSFDSSRNRRLNIP--LRKPNLSSIMGGIRRGVDRGSERI 38 MN N +KYVRFE+ SE+S FS D+ N + N P +RKP+LSS+M +RR ++ GSERI Sbjct: 2 MNPNQDKYVRFEEWKSEQSSFSIDNE-NSQDNRPFYVRKPSLSSLMSSVRRRLESGSERI 60 Query: 37 KSFR 26 S+R Sbjct: 61 SSWR 64 >ref|XP_004240079.1| PREDICTED: cyclic nucleotide-gated ion channel 1 isoform X1 [Solanum lycopersicum] Length = 723 Score = 57.0 bits (136), Expect = 1e-06 Identities = 34/64 (53%), Positives = 46/64 (71%), Gaps = 3/64 (4%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKS-FSFDSSRNRRLNIP--LRKPNLSSIMGGIRRGVDRGSERI 38 MN N +KYVRFE+ SE+S FS D+ N + N P +RKP+LSS+M +RR ++ GSERI Sbjct: 2 MNPNQDKYVRFEEWKSEQSSFSIDNE-NSQDNRPFYVRKPSLSSLMSSVRRRLESGSERI 60 Query: 37 KSFR 26 S+R Sbjct: 61 SSWR 64 >emb|CDP08690.1| unnamed protein product [Coffea canephora] Length = 623 Score = 56.2 bits (134), Expect = 2e-06 Identities = 30/64 (46%), Positives = 45/64 (70%), Gaps = 3/64 (4%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSR---NRRLNIPLRKPNLSSIMGGIRRGVDRGSERI 38 M + ++YVRFED SE++ SFDS + + R + +RKP+L S++ IRRG +RGSER+ Sbjct: 1 MELKQDRYVRFEDWSSERT-SFDSKQQFSSTRGLLSIRKPSLGSMISSIRRGFERGSERM 59 Query: 37 KSFR 26 KS + Sbjct: 60 KSLK 63 >ref|XP_015074516.1| PREDICTED: cyclic nucleotide-gated ion channel 1-like [Solanum pennellii] Length = 723 Score = 56.2 bits (134), Expect = 2e-06 Identities = 32/63 (50%), Positives = 43/63 (68%), Gaps = 2/63 (3%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKS-FSFDSSRNRRLN-IPLRKPNLSSIMGGIRRGVDRGSERIK 35 MN N +KYVRFE+ SE+S FS D+ ++ +RKP+LSS+M +RR RGSERI Sbjct: 2 MNPNQDKYVRFEEWKSEQSSFSIDNENSQDYRPFYVRKPSLSSLMSSVRRRFGRGSERIS 61 Query: 34 SFR 26 S+R Sbjct: 62 SWR 64 >gb|PHU17855.1| Cyclic nucleotide-gated ion channel 1 [Capsicum chinense] Length = 723 Score = 55.5 bits (132), Expect = 4e-06 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 4/65 (6%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKS-FSFD---SSRNRRLNIPLRKPNLSSIMGGIRRGVDRGSER 41 +N+ +KYVRFED SE+S FS D S NR ++ RKP+ SS+M +R ++RGSER Sbjct: 2 INLKQDKYVRFEDWKSEQSSFSIDGQNSQDNRHFHV--RKPSFSSLMSSFKRRLERGSER 59 Query: 40 IKSFR 26 I S+R Sbjct: 60 ISSWR 64 >ref|XP_011038085.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Populus euphratica] Length = 720 Score = 55.1 bits (131), Expect = 5e-06 Identities = 30/63 (47%), Positives = 39/63 (61%), Gaps = 2/63 (3%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSRNRRLNIPLR--KPNLSSIMGGIRRGVDRGSERIK 35 MNING K+VRF+D SEKSFS + + + R KP S+ IRRG + GSERI+ Sbjct: 1 MNINGNKFVRFQDWSSEKSFSSERQYSYEYGLYARKAKPIFYSVWDNIRRGWEMGSERIR 60 Query: 34 SFR 26 S + Sbjct: 61 SLK 63 >gb|PRQ58437.1| putative potassium channel, voltage-dependent, EAG/ELK/ERG [Rosa chinensis] Length = 564 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 6/67 (8%) Frame = -1 Query: 208 MNINGEKYVRFED------CDSEKSFSFDSSRNRRLNIPLRKPNLSSIMGGIRRGVDRGS 47 MN+ G K+VRF D SE+ FS D RN R +P++++++ IRRG DRGS Sbjct: 1 MNLKGTKFVRFADWHSEGSTSSEREFSTDDGRNPRSP----RPSVNAVLSSIRRGFDRGS 56 Query: 46 ERIKSFR 26 +R KSF+ Sbjct: 57 DRFKSFK 63 >gb|PNT03954.1| hypothetical protein POPTR_014G097900v3 [Populus trichocarpa] Length = 721 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSRNRRLNIPLR--KPNLSSIMGGIRRGVDRGSERIK 35 MN+NG K+VRF+D SEKSFS + + R KP S+ IRRG + GSERI+ Sbjct: 1 MNLNGNKFVRFQDWSSEKSFSSEQQYSNEYGFYARKAKPIFYSVWDNIRRGWEMGSERIR 60 Query: 34 SFR 26 S + Sbjct: 61 SLK 63 >ref|XP_016580009.1| PREDICTED: cyclic nucleotide-gated ion channel 1 [Capsicum annuum] gb|PHT81607.1| putative cyclic nucleotide-gated ion channel 6 [Capsicum annuum] Length = 723 Score = 54.7 bits (130), Expect = 7e-06 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 4/65 (6%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKS-FSFD---SSRNRRLNIPLRKPNLSSIMGGIRRGVDRGSER 41 +N+ +KYVRFED SE+S FS D S NR ++ RKP+ SS+M +R ++RGSER Sbjct: 2 INLKQDKYVRFEDRKSEQSSFSIDGQNSQDNRHFHV--RKPSFSSLMSSFKRRLERGSER 59 Query: 40 IKSFR 26 I S R Sbjct: 60 ISSLR 64 >ref|XP_002320197.2| hypothetical protein POPTR_0014s09350g [Populus trichocarpa] gb|PNT03955.1| hypothetical protein POPTR_014G097900v3 [Populus trichocarpa] Length = 723 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 2/63 (3%) Frame = -1 Query: 208 MNINGEKYVRFEDCDSEKSFSFDSSRNRRLNIPLR--KPNLSSIMGGIRRGVDRGSERIK 35 MN+NG K+VRF+D SEKSFS + + R KP S+ IRRG + GSERI+ Sbjct: 1 MNLNGNKFVRFQDWSSEKSFSSEQQYSNEYGFYARKAKPIFYSVWDNIRRGWEMGSERIR 60 Query: 34 SFR 26 S + Sbjct: 61 SLK 63 >ref|XP_024176142.1| cyclic nucleotide-gated ion channel 1-like [Rosa chinensis] ref|XP_024176143.1| cyclic nucleotide-gated ion channel 1-like [Rosa chinensis] ref|XP_024176144.1| cyclic nucleotide-gated ion channel 1-like [Rosa chinensis] Length = 725 Score = 54.7 bits (130), Expect = 7e-06 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 6/67 (8%) Frame = -1 Query: 208 MNINGEKYVRFED------CDSEKSFSFDSSRNRRLNIPLRKPNLSSIMGGIRRGVDRGS 47 MN+ G K+VRF D SE+ FS D RN R +P++++++ IRRG DRGS Sbjct: 1 MNLKGTKFVRFADWHSEGSTSSEREFSTDDGRNPRSP----RPSVNAVLSSIRRGFDRGS 56 Query: 46 ERIKSFR 26 +R KSF+ Sbjct: 57 DRFKSFK 63