BLASTX nr result
ID: Rehmannia31_contig00021479
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021479 (519 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020547903.1| FBD-associated F-box protein At5g38590-like ... 133 4e-33 gb|PIN22802.1| hypothetical protein CDL12_04480 [Handroanthus im... 130 6e-32 gb|PIN19802.1| hypothetical protein CDL12_07512 [Handroanthus im... 129 8e-32 ref|XP_022148229.1| putative FBD-associated F-box protein At5g22... 60 3e-07 ref|XP_022148228.1| uncharacterized protein LOC111016940 isoform... 60 3e-07 ref|XP_021984457.1| uncharacterized protein LOC110880181 isoform... 59 6e-07 ref|XP_021984455.1| uncharacterized protein LOC110880181 isoform... 59 6e-07 ref|XP_019233575.1| PREDICTED: uncharacterized protein LOC109214... 59 8e-07 ref|XP_016507287.1| PREDICTED: F-box/LRR-repeat protein 13-like ... 59 8e-07 ref|XP_022715084.1| putative F-box protein At5g40050 isoform X1 ... 59 8e-07 ref|XP_019233574.1| PREDICTED: uncharacterized protein LOC109214... 59 8e-07 ref|XP_009614723.1| PREDICTED: putative FBD-associated F-box pro... 59 8e-07 ref|XP_021681777.1| F-box/LRR-repeat protein At2g42730-like isof... 58 1e-06 ref|XP_021681775.1| F-box/LRR-repeat protein At2g42730-like isof... 58 1e-06 ref|XP_009782508.1| PREDICTED: putative FBD-associated F-box pro... 57 2e-06 ref|XP_009782506.1| PREDICTED: putative FBD-associated F-box pro... 57 2e-06 ref|XP_002535407.1| PREDICTED: F-box/LRR-repeat protein At3g5890... 57 3e-06 ref|XP_023749165.1| putative F-box/LRR-repeat protein At3g18150 ... 57 4e-06 ref|XP_023749162.1| putative FBD-associated F-box protein At5g56... 57 4e-06 ref|XP_012069034.1| F-box/FBD/LRR-repeat protein At5g53840 [Jatr... 57 4e-06 >ref|XP_020547903.1| FBD-associated F-box protein At5g38590-like [Sesamum indicum] Length = 580 Score = 133 bits (334), Expect = 4e-33 Identities = 73/126 (57%), Positives = 82/126 (65%), Gaps = 1/126 (0%) Frame = +1 Query: 145 VLWKTIWLRSLAKRDRFNKRSRIRR-TNDRKNLMIKPIGSACDDERFLRKRKIGQLGIES 321 +LWK I L L +R KRS RR TNDRKNLM+KPIGS D L KRKIG L +ES Sbjct: 1 MLWKRICLGYLVRRGHSTKRSSSRRGTNDRKNLMLKPIGSGFGDGGVLGKRKIGHLSVES 60 Query: 322 XXXXXXXXXXXXXXXXXYDRNADVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKN 501 DR+ DVDRISELPEPIIH I+ F+ TKDVVRTSILSKKWK+ Sbjct: 61 NKYRVRKKRKIRGDNGVCDRDVDVDRISELPEPIIHHIYGFMHSTKDVVRTSILSKKWKS 120 Query: 502 MFNSYL 519 MF+SYL Sbjct: 121 MFSSYL 126 >gb|PIN22802.1| hypothetical protein CDL12_04480 [Handroanthus impetiginosus] Length = 592 Score = 130 bits (326), Expect = 6e-32 Identities = 69/126 (54%), Positives = 78/126 (61%) Frame = +1 Query: 142 MVLWKTIWLRSLAKRDRFNKRSRIRRTNDRKNLMIKPIGSACDDERFLRKRKIGQLGIES 321 M LWK I LR+ RD K S+IRR +RK M+KP G + DDE L KRK G ES Sbjct: 1 MTLWKRICLRNALNRDLSAKGSKIRRGKNRKKFMLKPTGVSFDDEGLLGKRKRGHQSSES 60 Query: 322 XXXXXXXXXXXXXXXXXYDRNADVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKN 501 YD N DVDRISELP+ IIH IF+F+ CTKDVVRTSILS+KWKN Sbjct: 61 NKDRVRKKRKVGANNGVYDINTDVDRISELPDAIIHHIFSFMHCTKDVVRTSILSRKWKN 120 Query: 502 MFNSYL 519 FNSYL Sbjct: 121 TFNSYL 126 >gb|PIN19802.1| hypothetical protein CDL12_07512 [Handroanthus impetiginosus] Length = 592 Score = 129 bits (325), Expect = 8e-32 Identities = 69/126 (54%), Positives = 78/126 (61%) Frame = +1 Query: 142 MVLWKTIWLRSLAKRDRFNKRSRIRRTNDRKNLMIKPIGSACDDERFLRKRKIGQLGIES 321 M LWK I LR+ RD K S+IRR +RK M+KP G + DDE L KRK G ES Sbjct: 1 MTLWKRICLRNAFNRDLSAKGSKIRRGKNRKKFMLKPTGVSFDDEGLLGKRKRGHQSSES 60 Query: 322 XXXXXXXXXXXXXXXXXYDRNADVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKN 501 YD N DVDRISELP+ IIH IF+F+ CTKDVVRTSILS+KWKN Sbjct: 61 NKDRVRKKRKVGANNGVYDINTDVDRISELPDAIIHHIFSFMHCTKDVVRTSILSRKWKN 120 Query: 502 MFNSYL 519 FNSYL Sbjct: 121 TFNSYL 126 >ref|XP_022148229.1| putative FBD-associated F-box protein At5g22720 isoform X2 [Momordica charantia] Length = 530 Score = 59.7 bits (143), Expect = 3e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 391 VDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 VD ISELPE +IH IF+F++C K+ RTSILSKKW++ + S+ Sbjct: 68 VDIISELPESVIHHIFSFIRCAKEAARTSILSKKWRDAWKSF 109 >ref|XP_022148228.1| uncharacterized protein LOC111016940 isoform X1 [Momordica charantia] Length = 579 Score = 59.7 bits (143), Expect = 3e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 391 VDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 VD ISELPE +IH IF+F++C K+ RTSILSKKW++ + S+ Sbjct: 68 VDIISELPESVIHHIFSFIRCAKEAARTSILSKKWRDAWKSF 109 >ref|XP_021984457.1| uncharacterized protein LOC110880181 isoform X2 [Helianthus annuus] gb|OTG16863.1| putative F-box domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 590 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 391 VDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 VDRIS+LPEPIIH I + L+C KDV RT++ SKKW+++ S+ Sbjct: 81 VDRISDLPEPIIHHILSLLRCPKDVTRTTVWSKKWRSVCASF 122 >ref|XP_021984455.1| uncharacterized protein LOC110880181 isoform X1 [Helianthus annuus] ref|XP_021984456.1| uncharacterized protein LOC110880181 isoform X1 [Helianthus annuus] Length = 614 Score = 58.9 bits (141), Expect = 6e-07 Identities = 25/42 (59%), Positives = 34/42 (80%) Frame = +1 Query: 391 VDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 VDRIS+LPEPIIH I + L+C KDV RT++ SKKW+++ S+ Sbjct: 105 VDRISDLPEPIIHHILSLLRCPKDVTRTTVWSKKWRSVCASF 146 >ref|XP_019233575.1| PREDICTED: uncharacterized protein LOC109214142 isoform X2 [Nicotiana attenuata] gb|OIT27289.1| putative f-boxlrr-repeat protein [Nicotiana attenuata] Length = 591 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 388 DVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 D DRISELPE I+H I L+ KD+VRTSILSKKWK ++ S+ Sbjct: 34 DADRISELPEHILHHILCLLRWPKDIVRTSILSKKWKVIWESF 76 >ref|XP_016507287.1| PREDICTED: F-box/LRR-repeat protein 13-like [Nicotiana tabacum] Length = 591 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 388 DVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 D DRISELPE I+H I L+ KD+VRTSILSKKWK ++ S+ Sbjct: 34 DADRISELPEHILHHILCLLRWPKDIVRTSILSKKWKVIWESF 76 >ref|XP_022715084.1| putative F-box protein At5g40050 isoform X1 [Durio zibethinus] Length = 599 Score = 58.5 bits (140), Expect = 8e-07 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = +1 Query: 391 VDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 VD IS+LPE IIH I +FL+C KD RTSILSK+W++M+ S+ Sbjct: 63 VDYISQLPEHIIHHIISFLRCKKDAARTSILSKRWRDMWVSF 104 >ref|XP_019233574.1| PREDICTED: uncharacterized protein LOC109214142 isoform X1 [Nicotiana attenuata] Length = 615 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 388 DVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 D DRISELPE I+H I L+ KD+VRTSILSKKWK ++ S+ Sbjct: 58 DADRISELPEHILHHILCLLRWPKDIVRTSILSKKWKVIWESF 100 >ref|XP_009614723.1| PREDICTED: putative FBD-associated F-box protein At5g56400 [Nicotiana tomentosiformis] Length = 615 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/43 (62%), Positives = 33/43 (76%) Frame = +1 Query: 388 DVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 D DRISELPE I+H I L+ KD+VRTSILSKKWK ++ S+ Sbjct: 58 DADRISELPEHILHHILCLLRWPKDIVRTSILSKKWKVIWESF 100 >ref|XP_021681777.1| F-box/LRR-repeat protein At2g42730-like isoform X2 [Hevea brasiliensis] Length = 540 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +1 Query: 379 RNADVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSYL 519 R+ D IS+LPE IIH I + L+C KD RTSILSK+W++++ SYL Sbjct: 4 RSDSTDLISQLPEHIIHHILSLLRCGKDAARTSILSKRWRDIWASYL 50 >ref|XP_021681775.1| F-box/LRR-repeat protein At2g42730-like isoform X1 [Hevea brasiliensis] ref|XP_021681776.1| F-box/LRR-repeat protein At2g42730-like isoform X1 [Hevea brasiliensis] Length = 601 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/47 (55%), Positives = 35/47 (74%) Frame = +1 Query: 379 RNADVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSYL 519 R+ D IS+LPE IIH I + L+C KD RTSILSK+W++++ SYL Sbjct: 65 RSDSTDLISQLPEHIIHHILSLLRCGKDAARTSILSKRWRDIWASYL 111 >ref|XP_009782508.1| PREDICTED: putative FBD-associated F-box protein At5g56400 isoform X2 [Nicotiana sylvestris] ref|XP_009782509.1| PREDICTED: putative FBD-associated F-box protein At5g56400 isoform X2 [Nicotiana sylvestris] ref|XP_016437073.1| PREDICTED: putative FBD-associated F-box protein At5g56400 isoform X2 [Nicotiana tabacum] ref|XP_016437075.1| PREDICTED: putative FBD-associated F-box protein At5g56400 isoform X2 [Nicotiana tabacum] Length = 591 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +1 Query: 388 DVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNS 513 D DRISELPE I+H I L+ KD+VRTSILSKKWK ++ S Sbjct: 34 DADRISELPEHILHHILCLLRWPKDIVRTSILSKKWKVIWES 75 >ref|XP_009782506.1| PREDICTED: putative FBD-associated F-box protein At5g56400 isoform X1 [Nicotiana sylvestris] ref|XP_009782507.1| PREDICTED: putative FBD-associated F-box protein At5g56400 isoform X1 [Nicotiana sylvestris] ref|XP_016437072.1| PREDICTED: putative FBD-associated F-box protein At5g56400 isoform X1 [Nicotiana tabacum] Length = 615 Score = 57.4 bits (137), Expect = 2e-06 Identities = 27/42 (64%), Positives = 32/42 (76%) Frame = +1 Query: 388 DVDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNS 513 D DRISELPE I+H I L+ KD+VRTSILSKKWK ++ S Sbjct: 58 DADRISELPEHILHHILCLLRWPKDIVRTSILSKKWKVIWES 99 >ref|XP_002535407.1| PREDICTED: F-box/LRR-repeat protein At3g58900 [Ricinus communis] gb|EEF26976.1| conserved hypothetical protein [Ricinus communis] Length = 337 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/49 (53%), Positives = 36/49 (73%), Gaps = 1/49 (2%) Frame = +1 Query: 376 DRNAD-VDRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSYL 519 DR +D +D IS+LP +IH I + L+C KD RTSILSK+W+ ++ SYL Sbjct: 63 DRRSDSIDLISQLPNHVIHHILSLLRCKKDAARTSILSKRWRAIWASYL 111 >ref|XP_023749165.1| putative F-box/LRR-repeat protein At3g18150 isoform X2 [Lactuca sativa] Length = 559 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 394 DRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 DRISELPEPIIH I + L C +DV R + LSKKW++++ S+ Sbjct: 102 DRISELPEPIIHHILSLLHCPRDVARITALSKKWRSIWASF 142 >ref|XP_023749162.1| putative FBD-associated F-box protein At5g56400 isoform X1 [Lactuca sativa] ref|XP_023749163.1| putative FBD-associated F-box protein At5g56400 isoform X1 [Lactuca sativa] Length = 592 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/41 (58%), Positives = 32/41 (78%) Frame = +1 Query: 394 DRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 DRISELPEPIIH I + L C +DV R + LSKKW++++ S+ Sbjct: 102 DRISELPEPIIHHILSLLHCPRDVARITALSKKWRSIWASF 142 >ref|XP_012069034.1| F-box/FBD/LRR-repeat protein At5g53840 [Jatropha curcas] ref|XP_012069035.1| F-box/FBD/LRR-repeat protein At5g53840 [Jatropha curcas] gb|KDP40815.1| hypothetical protein JCGZ_24814 [Jatropha curcas] Length = 596 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/41 (60%), Positives = 32/41 (78%) Frame = +1 Query: 394 DRISELPEPIIHQIFAFLQCTKDVVRTSILSKKWKNMFNSY 516 D IS+LPE IIH I +FL C KD RTSILSK+W++++ SY Sbjct: 66 DLISQLPEHIIHHILSFLHCKKDAARTSILSKRWRDVWFSY 106