BLASTX nr result
ID: Rehmannia31_contig00021149
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00021149 (388 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843682.1| PREDICTED: (-)-isopiperitenone reductase-lik... 55 3e-06 >ref|XP_012843682.1| PREDICTED: (-)-isopiperitenone reductase-like [Erythranthe guttata] gb|EYU32087.1| hypothetical protein MIMGU_mgv1a010340mg [Erythranthe guttata] Length = 315 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/39 (71%), Positives = 30/39 (76%) Frame = -3 Query: 386 NLGPLSASGAAEGPVELALLPHGRRPSGLLFYRKEISYF 270 NLGPLSA AAE PV LALLP G PSGL FYRKE+ Y+ Sbjct: 278 NLGPLSAEEAAESPVRLALLPDG-GPSGLFFYRKEVFYY 315