BLASTX nr result
ID: Rehmannia31_contig00020852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020852 (959 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZN11908.1| hypothetical protein DCAR_004564 [Daucus carota s... 70 4e-11 >gb|KZN11908.1| hypothetical protein DCAR_004564 [Daucus carota subsp. sativus] Length = 152 Score = 70.5 bits (171), Expect = 4e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +2 Query: 575 GMYVANRSSYKITQLSENVYICRLGSVLSYLYGCFDQAWKE 697 GMYVANR+S KITQL++NVYICR GS SYLYG FDQAWKE Sbjct: 36 GMYVANRASDKITQLTDNVYICRSGSGSSYLYGFFDQAWKE 76