BLASTX nr result
ID: Rehmannia31_contig00020797
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020797 (351 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099088.1| probable inactive ATP-dependent zinc metallo... 74 7e-13 gb|PIN02985.1| hypothetical protein CDL12_24499 [Handroanthus im... 67 2e-10 >ref|XP_011099088.1| probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic [Sesamum indicum] Length = 616 Score = 73.9 bits (180), Expect = 7e-13 Identities = 36/61 (59%), Positives = 44/61 (72%) Frame = -1 Query: 183 MASLPLAWNNGFLIAQEKLNIRVGKSEFFGRPRNFSYPLSKHCFSFVNNPFLLTNCPHKS 4 MAS PLAWN+GFLIAQE LN+ VG S+ G RN S+ LS++CFS V+ P LL+ HK Sbjct: 1 MASFPLAWNDGFLIAQENLNLCVGNSKLLGGHRNLSFSLSQNCFSSVSCPLLLSCSSHKR 60 Query: 3 Q 1 Q Sbjct: 61 Q 61 >gb|PIN02985.1| hypothetical protein CDL12_24499 [Handroanthus impetiginosus] Length = 545 Score = 66.6 bits (161), Expect = 2e-10 Identities = 35/61 (57%), Positives = 42/61 (68%) Frame = -1 Query: 183 MASLPLAWNNGFLIAQEKLNIRVGKSEFFGRPRNFSYPLSKHCFSFVNNPFLLTNCPHKS 4 MAS PLA N+GFLI Q+KLN+ VG S+ G R SY LSK+ FS V+NPFLL +K Sbjct: 1 MASFPLASNDGFLICQDKLNLCVGNSKLLGGHRTLSYSLSKNYFSSVSNPFLLRYSYYKP 60 Query: 3 Q 1 Q Sbjct: 61 Q 61