BLASTX nr result
ID: Rehmannia31_contig00020519
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020519 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022891276.1| squamosa promoter-binding-like protein 16 [O... 135 9e-36 ref|XP_019231213.1| PREDICTED: teosinte glume architecture 1-lik... 134 1e-35 ref|XP_022885332.1| teosinte glume architecture 1-like [Olea eur... 134 2e-35 ref|XP_022885384.1| teosinte glume architecture 1-like [Olea eur... 134 2e-35 gb|AUW52987.1| squamosa promoter binding-like protein 13 [Petuni... 134 3e-35 gb|PIM97737.1| hypothetical protein CDL12_29790 [Handroanthus im... 133 4e-35 ref|XP_019180911.1| PREDICTED: squamosa promoter-binding-like pr... 132 5e-35 ref|XP_019180910.1| PREDICTED: squamosa promoter-binding-like pr... 132 5e-35 ref|XP_012849834.1| PREDICTED: squamosa promoter-binding-like pr... 126 3e-34 gb|EYU26977.1| hypothetical protein MIMGU_mgv1a0145091mg, partia... 126 3e-34 ref|XP_016482449.1| PREDICTED: squamosa promoter-binding-like pr... 129 1e-33 ref|XP_009764314.1| PREDICTED: squamosa promoter-binding-like pr... 129 1e-33 gb|AOC59148.1| squamosa promter-binding-like protein 6 [Nicotian... 129 1e-33 ref|XP_016443568.1| PREDICTED: teosinte glume architecture 1-lik... 129 1e-33 ref|XP_019199799.1| PREDICTED: squamosa promoter-binding-like pr... 128 2e-33 ref|XP_019199796.1| PREDICTED: putative squamosa promoter-bindin... 128 2e-33 ref|XP_022881716.1| squamosa promoter-binding-like protein 16 [O... 129 2e-33 ref|NP_001311938.1| teosinte glume architecture 1-like [Nicotian... 129 2e-33 emb|CDP13362.1| unnamed protein product [Coffea canephora] 128 4e-33 gb|KZV24451.1| squamosa promoter-binding-like protein 16-like [D... 127 8e-33 >ref|XP_022891276.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022891277.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022891278.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] Length = 326 Score = 135 bits (339), Expect = 9e-36 Identities = 62/75 (82%), Positives = 68/75 (90%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 M+ S SGSSKRAKAPG +QV QCLVDGC+ADLSLCR+YHRRHKVCE HSKTA+V+IGG Sbjct: 1 MDSSSFSGSSKRAKAPGNVTQVAQCLVDGCDADLSLCREYHRRHKVCEAHSKTARVTIGG 60 Query: 395 REQRFCQQCSRFHSL 439 REQRFCQQCSRFHSL Sbjct: 61 REQRFCQQCSRFHSL 75 >ref|XP_019231213.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] ref|XP_019231214.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] ref|XP_019231215.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] ref|XP_019231216.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] ref|XP_019231218.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana attenuata] gb|OIT28908.1| squamosa promoter-binding-like protein 16 [Nicotiana attenuata] Length = 327 Score = 134 bits (338), Expect = 1e-35 Identities = 63/75 (84%), Positives = 67/75 (89%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 ME S SGSSKRAKAPG +QV CLVDGCNADLS CR+YHRRHKVCEVHSKTAKV+IGG Sbjct: 1 MESSSSSGSSKRAKAPGNIAQVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGG 60 Query: 395 REQRFCQQCSRFHSL 439 R+QRFCQQCSRFHSL Sbjct: 61 RDQRFCQQCSRFHSL 75 >ref|XP_022885332.1| teosinte glume architecture 1-like [Olea europaea var. sylvestris] ref|XP_022885337.1| teosinte glume architecture 1-like [Olea europaea var. sylvestris] ref|XP_022885345.1| teosinte glume architecture 1-like [Olea europaea var. sylvestris] ref|XP_022885354.1| teosinte glume architecture 1-like [Olea europaea var. sylvestris] ref|XP_022885362.1| teosinte glume architecture 1-like [Olea europaea var. sylvestris] ref|XP_022885372.1| teosinte glume architecture 1-like [Olea europaea var. sylvestris] Length = 322 Score = 134 bits (337), Expect = 2e-35 Identities = 61/75 (81%), Positives = 68/75 (90%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 M+ + SGSSKRAKAPG +Q+ QCLVDGC ADLSLCR+YHRRHKVCE+HSKTAKV+IGG Sbjct: 1 MDSSAFSGSSKRAKAPGNVTQIAQCLVDGCVADLSLCREYHRRHKVCEIHSKTAKVTIGG 60 Query: 395 REQRFCQQCSRFHSL 439 REQRFCQQCSRFHSL Sbjct: 61 REQRFCQQCSRFHSL 75 >ref|XP_022885384.1| teosinte glume architecture 1-like [Olea europaea var. sylvestris] Length = 322 Score = 134 bits (337), Expect = 2e-35 Identities = 61/75 (81%), Positives = 68/75 (90%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 M+ + SGSSKRAKAPG +Q+ QCLVDGC ADLSLCR+YHRRHKVCE+HSKTAKV+IGG Sbjct: 1 MDSSAFSGSSKRAKAPGNVTQIAQCLVDGCVADLSLCREYHRRHKVCEIHSKTAKVTIGG 60 Query: 395 REQRFCQQCSRFHSL 439 REQRFCQQCSRFHSL Sbjct: 61 REQRFCQQCSRFHSL 75 >gb|AUW52987.1| squamosa promoter binding-like protein 13 [Petunia x hybrida] Length = 329 Score = 134 bits (336), Expect = 3e-35 Identities = 62/69 (89%), Positives = 64/69 (92%) Frame = +2 Query: 233 SGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQRFC 412 SGSSKRAKAPG +QV CLVDGCNADLS CR+YHRRHKVCEVHSKTAKVSIGGREQRFC Sbjct: 4 SGSSKRAKAPGSLAQVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVSIGGREQRFC 63 Query: 413 QQCSRFHSL 439 QQCSRFHSL Sbjct: 64 QQCSRFHSL 72 >gb|PIM97737.1| hypothetical protein CDL12_29790 [Handroanthus impetiginosus] Length = 317 Score = 133 bits (334), Expect = 4e-35 Identities = 62/75 (82%), Positives = 65/75 (86%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 ME S SGSSKRAKAPG + V CLVDGCNADLSLCRDYHRRHKVCE+HSKT V+IGG Sbjct: 1 MESSSFSGSSKRAKAPGNFTPVAHCLVDGCNADLSLCRDYHRRHKVCEIHSKTPVVTIGG 60 Query: 395 REQRFCQQCSRFHSL 439 REQRFCQQCSRFHSL Sbjct: 61 REQRFCQQCSRFHSL 75 >ref|XP_019180911.1| PREDICTED: squamosa promoter-binding-like protein 13A isoform X2 [Ipomoea nil] Length = 310 Score = 132 bits (333), Expect = 5e-35 Identities = 61/71 (85%), Positives = 64/71 (90%) Frame = +2 Query: 227 SISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQR 406 S+SGSSKRAKAPG QV CLVDGCNADLS CR+YHRRHKVCEVHSKT KV+IGGREQR Sbjct: 6 SLSGSSKRAKAPGSVGQVAHCLVDGCNADLSRCREYHRRHKVCEVHSKTPKVTIGGREQR 65 Query: 407 FCQQCSRFHSL 439 FCQQCSRFHSL Sbjct: 66 FCQQCSRFHSL 76 >ref|XP_019180910.1| PREDICTED: squamosa promoter-binding-like protein 13A isoform X1 [Ipomoea nil] Length = 315 Score = 132 bits (333), Expect = 5e-35 Identities = 61/71 (85%), Positives = 64/71 (90%) Frame = +2 Query: 227 SISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQR 406 S+SGSSKRAKAPG QV CLVDGCNADLS CR+YHRRHKVCEVHSKT KV+IGGREQR Sbjct: 6 SLSGSSKRAKAPGSVGQVAHCLVDGCNADLSRCREYHRRHKVCEVHSKTPKVTIGGREQR 65 Query: 407 FCQQCSRFHSL 439 FCQQCSRFHSL Sbjct: 66 FCQQCSRFHSL 76 >ref|XP_012849834.1| PREDICTED: squamosa promoter-binding-like protein 13A, partial [Erythranthe guttata] Length = 152 Score = 126 bits (316), Expect = 3e-34 Identities = 56/70 (80%), Positives = 62/70 (88%) Frame = +2 Query: 230 ISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQRF 409 + SSKRA+APG +Q+ CLVDGCNADLSLCRDYHRRHKVCE HSKT+KV+IGGRE RF Sbjct: 1 MESSSKRARAPGNMTQIAHCLVDGCNADLSLCRDYHRRHKVCETHSKTSKVTIGGRELRF 60 Query: 410 CQQCSRFHSL 439 CQQCSRFHSL Sbjct: 61 CQQCSRFHSL 70 >gb|EYU26977.1| hypothetical protein MIMGU_mgv1a0145091mg, partial [Erythranthe guttata] gb|EYU26978.1| hypothetical protein MIMGU_mgv1a0145091mg, partial [Erythranthe guttata] Length = 153 Score = 126 bits (316), Expect = 3e-34 Identities = 56/70 (80%), Positives = 62/70 (88%) Frame = +2 Query: 230 ISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQRF 409 + SSKRA+APG +Q+ CLVDGCNADLSLCRDYHRRHKVCE HSKT+KV+IGGRE RF Sbjct: 1 MESSSKRARAPGNMTQIAHCLVDGCNADLSLCRDYHRRHKVCETHSKTSKVTIGGRELRF 60 Query: 410 CQQCSRFHSL 439 CQQCSRFHSL Sbjct: 61 CQQCSRFHSL 70 >ref|XP_016482449.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana tabacum] ref|XP_016482450.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana tabacum] ref|XP_016482451.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana tabacum] ref|XP_016482452.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana tabacum] ref|XP_016482453.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana tabacum] Length = 329 Score = 129 bits (325), Expect = 1e-33 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = +2 Query: 227 SISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQR 406 S S SSKRAKAPG +QV CLVDGCNADLS CR+YHRRHKVCEVHSKTAKV+IGGR+QR Sbjct: 6 SSSSSSKRAKAPGNIAQVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQR 65 Query: 407 FCQQCSRFHSL 439 FCQQCSRFHSL Sbjct: 66 FCQQCSRFHSL 76 >ref|XP_009764314.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] ref|XP_009764315.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] ref|XP_009764316.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] ref|XP_009764317.1| PREDICTED: squamosa promoter-binding-like protein 16 [Nicotiana sylvestris] Length = 329 Score = 129 bits (325), Expect = 1e-33 Identities = 60/71 (84%), Positives = 64/71 (90%) Frame = +2 Query: 227 SISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQR 406 S S SSKRAKAPG +QV CLVDGCNADLS CR+YHRRHKVCEVHSKTAKV+IGGR+QR Sbjct: 6 SSSSSSKRAKAPGNIAQVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQR 65 Query: 407 FCQQCSRFHSL 439 FCQQCSRFHSL Sbjct: 66 FCQQCSRFHSL 76 >gb|AOC59148.1| squamosa promter-binding-like protein 6 [Nicotiana tabacum] Length = 303 Score = 129 bits (323), Expect = 1e-33 Identities = 59/69 (85%), Positives = 63/69 (91%) Frame = +2 Query: 233 SGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQRFC 412 S SSKRAKAPG +QV CLVDGCNADLS CR+YHRRHKVCEVHSKTAKV+IGGR+QRFC Sbjct: 4 SSSSKRAKAPGNIAQVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFC 63 Query: 413 QQCSRFHSL 439 QQCSRFHSL Sbjct: 64 QQCSRFHSL 72 >ref|XP_016443568.1| PREDICTED: teosinte glume architecture 1-like isoform X2 [Nicotiana tabacum] Length = 310 Score = 129 bits (323), Expect = 1e-33 Identities = 59/69 (85%), Positives = 63/69 (91%) Frame = +2 Query: 233 SGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQRFC 412 S SSKRAKAPG +QV CLVDGCNADLS CR+YHRRHKVCEVHSKTAKV+IGGR+QRFC Sbjct: 4 SSSSKRAKAPGNIAQVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFC 63 Query: 413 QQCSRFHSL 439 QQCSRFHSL Sbjct: 64 QQCSRFHSL 72 >ref|XP_019199799.1| PREDICTED: squamosa promoter-binding-like protein 16 isoform X2 [Ipomoea nil] Length = 301 Score = 128 bits (322), Expect = 2e-33 Identities = 60/75 (80%), Positives = 64/75 (85%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 ME S S SSKRAKAPG QV CLVDGCNADLS CR+YHRRHKVCE+HSKTAKV++GG Sbjct: 1 MESSSSSSSSKRAKAPGNAVQVANCLVDGCNADLSQCREYHRRHKVCELHSKTAKVTVGG 60 Query: 395 REQRFCQQCSRFHSL 439 RE RFCQQCSRFHSL Sbjct: 61 RELRFCQQCSRFHSL 75 >ref|XP_019199796.1| PREDICTED: putative squamosa promoter-binding-like protein 19 isoform X1 [Ipomoea nil] ref|XP_019199798.1| PREDICTED: putative squamosa promoter-binding-like protein 19 isoform X1 [Ipomoea nil] Length = 302 Score = 128 bits (322), Expect = 2e-33 Identities = 60/75 (80%), Positives = 64/75 (85%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 ME S S SSKRAKAPG QV CLVDGCNADLS CR+YHRRHKVCE+HSKTAKV++GG Sbjct: 1 MESSSSSSSSKRAKAPGNAVQVANCLVDGCNADLSQCREYHRRHKVCELHSKTAKVTVGG 60 Query: 395 REQRFCQQCSRFHSL 439 RE RFCQQCSRFHSL Sbjct: 61 RELRFCQQCSRFHSL 75 >ref|XP_022881716.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022881717.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022881718.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022881719.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022881720.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022881721.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] ref|XP_022881722.1| squamosa promoter-binding-like protein 16 [Olea europaea var. sylvestris] Length = 321 Score = 129 bits (323), Expect = 2e-33 Identities = 61/75 (81%), Positives = 62/75 (82%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 M S SGSSKRAKAPG QV C VDGCNADLSLCRDYHRRHKVCE+HSKT KV IGG Sbjct: 1 MASSSFSGSSKRAKAPGNIIQVAHCSVDGCNADLSLCRDYHRRHKVCEIHSKTPKVMIGG 60 Query: 395 REQRFCQQCSRFHSL 439 RE RFCQQCSRFHSL Sbjct: 61 RELRFCQQCSRFHSL 75 >ref|NP_001311938.1| teosinte glume architecture 1-like [Nicotiana tabacum] ref|XP_009621035.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana tomentosiformis] ref|XP_009621036.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana tomentosiformis] ref|XP_009621037.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana tomentosiformis] ref|XP_009621038.1| PREDICTED: teosinte glume architecture 1-like [Nicotiana tomentosiformis] ref|XP_016443564.1| PREDICTED: teosinte glume architecture 1-like isoform X1 [Nicotiana tabacum] ref|XP_016443565.1| PREDICTED: teosinte glume architecture 1-like isoform X1 [Nicotiana tabacum] ref|XP_016443566.1| PREDICTED: teosinte glume architecture 1-like isoform X1 [Nicotiana tabacum] ref|XP_016443567.1| PREDICTED: teosinte glume architecture 1-like isoform X1 [Nicotiana tabacum] dbj|BAU51043.1| squamosa promoter binding protein NtabSPL13 [Nicotiana tabacum] Length = 326 Score = 129 bits (323), Expect = 2e-33 Identities = 59/69 (85%), Positives = 63/69 (91%) Frame = +2 Query: 233 SGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGGREQRFC 412 S SSKRAKAPG +QV CLVDGCNADLS CR+YHRRHKVCEVHSKTAKV+IGGR+QRFC Sbjct: 4 SSSSKRAKAPGNIAQVAHCLVDGCNADLSQCREYHRRHKVCEVHSKTAKVTIGGRDQRFC 63 Query: 413 QQCSRFHSL 439 QQCSRFHSL Sbjct: 64 QQCSRFHSL 72 >emb|CDP13362.1| unnamed protein product [Coffea canephora] Length = 323 Score = 128 bits (321), Expect = 4e-33 Identities = 59/75 (78%), Positives = 65/75 (86%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 ME S++GSSKRAKAPG +Q+ CLVDGCNADLS CRDYHRRHKVCE HSK +KV+IGG Sbjct: 1 MESSSLTGSSKRAKAPGNVTQMAHCLVDGCNADLSQCRDYHRRHKVCEHHSKASKVTIGG 60 Query: 395 REQRFCQQCSRFHSL 439 RE RFCQQCSRFHSL Sbjct: 61 RELRFCQQCSRFHSL 75 >gb|KZV24451.1| squamosa promoter-binding-like protein 16-like [Dorcoceras hygrometricum] Length = 325 Score = 127 bits (319), Expect = 8e-33 Identities = 60/75 (80%), Positives = 63/75 (84%) Frame = +2 Query: 215 MELPSISGSSKRAKAPGPNSQVVQCLVDGCNADLSLCRDYHRRHKVCEVHSKTAKVSIGG 394 M+ GSSKRAKAP S CLVDGCNADLSLCRDYHRRHKVCE+HSKTAKV+IGG Sbjct: 1 MDSSPFPGSSKRAKAPASGSNT-HCLVDGCNADLSLCRDYHRRHKVCEIHSKTAKVTIGG 59 Query: 395 REQRFCQQCSRFHSL 439 REQRFCQQCSRFHSL Sbjct: 60 REQRFCQQCSRFHSL 74