BLASTX nr result
ID: Rehmannia31_contig00020463
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020463 (450 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK38361.1| unknown [Medicago truncatula] 62 7e-10 gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlise... 51 1e-09 ref|XP_019051553.1| PREDICTED: uncharacterized protein LOC109114... 55 3e-06 >gb|AFK38361.1| unknown [Medicago truncatula] Length = 82 Score = 62.0 bits (149), Expect = 7e-10 Identities = 28/40 (70%), Positives = 31/40 (77%) Frame = +3 Query: 324 NGLRGSATQLTFIIKYRYCIGGSHCERPVTG*FMGRAKEC 443 NGLRGS TQL FI+KYRYCI CERP+T FMGRA +C Sbjct: 32 NGLRGSTTQLIFILKYRYCIARFCCERPITRYFMGRAHKC 71 >gb|EPS74396.1| hypothetical protein M569_00359, partial [Genlisea aurea] Length = 106 Score = 51.2 bits (121), Expect(3) = 1e-09 Identities = 22/25 (88%), Positives = 23/25 (92%) Frame = -3 Query: 76 KAGFLLFFVSAHDLNESHIHPSTCS 2 K G L+FFVSAHDLNESHIHPSTCS Sbjct: 46 KPGLLVFFVSAHDLNESHIHPSTCS 70 Score = 30.0 bits (66), Expect(3) = 1e-09 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -2 Query: 206 IGFAPMETINFIHNRGINLLIF 141 IGFAPM+TI FIH +L+F Sbjct: 1 IGFAPMKTIRFIHISSYLVLVF 22 Score = 28.5 bits (62), Expect(3) = 1e-09 Identities = 14/25 (56%), Positives = 18/25 (72%) Frame = -1 Query: 147 YF*IVNGIPSSILSYSMVLIIQTGK 73 +F IVNG+ SS L YS+ II +GK Sbjct: 22 FFLIVNGVRSSCLCYSLRHIIPSGK 46 >ref|XP_019051553.1| PREDICTED: uncharacterized protein LOC109114016 [Nelumbo nucifera] Length = 187 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = +2 Query: 185 FPLVQIQSPEFKMRSNSPLVANGYPLSGE 271 F LVQIQSP+F+MRSNSPLVANGYPL GE Sbjct: 142 FSLVQIQSPQFEMRSNSPLVANGYPLRGE 170