BLASTX nr result
ID: Rehmannia31_contig00020366
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020366 (359 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14751.1| ATP-dependent Clp protease, proteolytic subunit [... 100 1e-22 ref|XP_011097141.1| ATP-dependent Clp protease proteolytic subun... 97 8e-22 ref|XP_011099493.1| ATP-dependent Clp protease proteolytic subun... 87 9e-18 ref|XP_012832588.1| PREDICTED: ATP-dependent Clp protease proteo... 79 8e-15 gb|KZV47911.1| ATP-dependent Clp protease proteolytic subunit 3,... 62 1e-08 ref|XP_022895218.1| ATP-dependent Clp protease proteolytic subun... 61 2e-08 >gb|PIN14751.1| ATP-dependent Clp protease, proteolytic subunit [Handroanthus impetiginosus] Length = 352 Score = 100 bits (248), Expect = 1e-22 Identities = 54/92 (58%), Positives = 64/92 (69%), Gaps = 3/92 (3%) Frame = +3 Query: 93 MERAILT---ASSTHPGPTGAAAFLRHSSPIFSPSHNSFSQFFPISTISNRSDCQHTSSV 263 MER ILT ASST P P AFLR S+P FS SHNS QFF I+ SN + ++T S Sbjct: 1 MERGILTFTAASSTPPEPAAVTAFLRCSAPAFSQSHNSCRQFFAINPTSNNRNNRNTISG 60 Query: 264 RSKRNLSVKALNDSLSSKWDVSNYAAPSWLPR 359 RS NLS+KALN+ L+S W+VSNYAAP WLP+ Sbjct: 61 RSSGNLSLKALNNRLTSYWNVSNYAAPKWLPK 92 >ref|XP_011097141.1| ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Sesamum indicum] Length = 323 Score = 97.4 bits (241), Expect = 8e-22 Identities = 55/92 (59%), Positives = 64/92 (69%), Gaps = 3/92 (3%) Frame = +3 Query: 93 MERAILTAS---STHPGPTGAAAFLRHSSPIFSPSHNSFSQFFPISTISNRSDCQHTSSV 263 ME I T + ST P P AAAFLR + PIFS HN+F FFPI+T S+ Q+ S Sbjct: 1 MESGIATFTGTLSTPPRPA-AAAFLRQNGPIFSQRHNNFRHFFPITTTSSSWVGQNASCG 59 Query: 264 RSKRNLSVKALNDSLSSKWDVSNYAAPSWLPR 359 RSK +L VK+LN SLSSKW+VSNYAAPSWLPR Sbjct: 60 RSKGSLRVKSLNHSLSSKWEVSNYAAPSWLPR 91 >ref|XP_011099493.1| ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Sesamum indicum] Length = 330 Score = 86.7 bits (213), Expect = 9e-18 Identities = 53/92 (57%), Positives = 60/92 (65%), Gaps = 3/92 (3%) Frame = +3 Query: 93 MERAILT---ASSTHPGPTGAAAFLRHSSPIFSPSHNSFSQFFPISTISNRSDCQHTSSV 263 MER LT +SST P P AA F H +PIF SH+ F QFF + T ++C S Sbjct: 1 MERGCLTFTTSSSTPPRP--AAVFPCHRAPIFGQSHDKFQQFFRMRT----ANCGSISG- 53 Query: 264 RSKRNLSVKALNDSLSSKWDVSNYAAPSWLPR 359 SK +LSVKALN SLSS WDVSNYAAPSWLPR Sbjct: 54 -SKGSLSVKALNQSLSSNWDVSNYAAPSWLPR 84 >ref|XP_012832588.1| PREDICTED: ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Erythranthe guttata] gb|EYU41319.1| hypothetical protein MIMGU_mgv1a010129mg [Erythranthe guttata] Length = 321 Score = 78.6 bits (192), Expect = 8e-15 Identities = 49/92 (53%), Positives = 56/92 (60%), Gaps = 3/92 (3%) Frame = +3 Query: 93 MERAILT---ASSTHPGPTGAAAFLRHSSPIFSPSHNSFSQFFPISTISNRSDCQHTSSV 263 ME ILT +SS HP AA LR S+ IF+P +SF QF S ISN S Sbjct: 1 MEGGILTFTASSSAHP-----AALLRRSATIFTPPRDSFRQFSTTSKISNGK-----KSS 50 Query: 264 RSKRNLSVKALNDSLSSKWDVSNYAAPSWLPR 359 R N SVKA N+SLSS W+VSNYAAP+WLPR Sbjct: 51 RKIGNFSVKASNNSLSSNWEVSNYAAPAWLPR 82 >gb|KZV47911.1| ATP-dependent Clp protease proteolytic subunit 3, chloroplastic [Dorcoceras hygrometricum] Length = 341 Score = 61.6 bits (148), Expect = 1e-08 Identities = 38/85 (44%), Positives = 52/85 (61%), Gaps = 3/85 (3%) Frame = +3 Query: 114 ASSTHPGPTGAAA--FLRHSSPIFSPSHNSFSQFFPISTISNRSDCQHTSSVRSKRNLSV 287 ASS P P A A R +S I P+H S +++ S+ S +++ RSK NL V Sbjct: 11 ASSALPSPAAALASSHCRGTSIICQPNHPLSS--IRLASYSDSSQITSSTTSRSKGNLIV 68 Query: 288 KALNDSLSSK-WDVSNYAAPSWLPR 359 +A+N +S++ WDVSNYAAPSWLPR Sbjct: 69 RAINQRISTRNWDVSNYAAPSWLPR 93 >ref|XP_022895218.1| ATP-dependent Clp protease proteolytic subunit 3, chloroplastic-like [Olea europaea var. sylvestris] Length = 335 Score = 60.8 bits (146), Expect = 2e-08 Identities = 37/88 (42%), Positives = 46/88 (52%), Gaps = 2/88 (2%) Frame = +3 Query: 102 AILTASSTHPGPTGAAAFLRHSSPIFSPSHNSFSQFFPISTISNRSDCQHTSSVRSKR-- 275 A TASS H + FL H I SH + PIS+ + + C+ S + Sbjct: 7 AFTTASSAH------STFLHHRPTILEQSHTNSCILHPISSPISSNICRTRKGKFSVKAV 60 Query: 276 NLSVKALNDSLSSKWDVSNYAAPSWLPR 359 N S + N +LSS WDVSNYAAPSWLPR Sbjct: 61 NQSSSSRNQTLSSSWDVSNYAAPSWLPR 88