BLASTX nr result
ID: Rehmannia31_contig00020338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020338 (480 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN02451.1| Copper chaperone [Handroanthus impetiginosus] 60 2e-08 ref|XP_020548183.1| heavy metal-associated isoprenylated plant p... 55 6e-07 ref|XP_011074143.1| heavy metal-associated isoprenylated plant p... 55 1e-06 ref|XP_009345527.1| PREDICTED: heavy metal-associated isoprenyla... 55 2e-06 dbj|GAV59295.1| HMA domain-containing protein [Cephalotus follic... 55 2e-06 gb|PON63486.1| Heavy metal-associated domain containing protein ... 53 9e-06 gb|PNX98131.1| heavy metal-associated isoprenylated plant protei... 53 9e-06 ref|XP_006354022.1| PREDICTED: heavy metal-associated isoprenyla... 53 9e-06 >gb|PIN02451.1| Copper chaperone [Handroanthus impetiginosus] Length = 149 Score = 60.1 bits (144), Expect = 2e-08 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNSXXXXXXQLNTVAVKIRMDCEGC 479 MGVSGTLEYLS+ LS++ QLNTVAVKIRMDCEGC Sbjct: 1 MGVSGTLEYLSDLLSSTKKKKKKQLNTVAVKIRMDCEGC 39 >ref|XP_020548183.1| heavy metal-associated isoprenylated plant protein 24-like [Sesamum indicum] Length = 100 Score = 55.1 bits (131), Expect = 6e-07 Identities = 29/40 (72%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNSXXXXXX-QLNTVAVKIRMDCEGC 479 MGVSGTLEYLS+ L+ S QLNTVAVKIRMDCEGC Sbjct: 1 MGVSGTLEYLSDLLAGSGKKKKKKQLNTVAVKIRMDCEGC 40 >ref|XP_011074143.1| heavy metal-associated isoprenylated plant protein 24-like [Sesamum indicum] Length = 143 Score = 55.1 bits (131), Expect = 1e-06 Identities = 29/40 (72%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNSXXXXXX-QLNTVAVKIRMDCEGC 479 MGVSGTLEYLS+ L+ S QLNTVAVKIRMDCEGC Sbjct: 1 MGVSGTLEYLSDLLAGSGKKKKKKQLNTVAVKIRMDCEGC 40 >ref|XP_009345527.1| PREDICTED: heavy metal-associated isoprenylated plant protein 22-like [Pyrus x bretschneideri] Length = 150 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNSXXXXXXQLNTVAVKIRMDCEGC 479 MG+ GTLEYLS+ LS++ Q+ TVAVKIRMDCEGC Sbjct: 1 MGIQGTLEYLSDVLSSAKKGKKKQMQTVAVKIRMDCEGC 39 >dbj|GAV59295.1| HMA domain-containing protein [Cephalotus follicularis] Length = 174 Score = 55.1 bits (131), Expect = 2e-06 Identities = 25/39 (64%), Positives = 30/39 (76%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNSXXXXXXQLNTVAVKIRMDCEGC 479 MGV GTLEY S+ LS++ Q+NTVA+KIRMDCEGC Sbjct: 1 MGVQGTLEYFSDLLSSAKKKKRKQINTVALKIRMDCEGC 39 >gb|PON63486.1| Heavy metal-associated domain containing protein [Parasponia andersonii] Length = 149 Score = 53.1 bits (126), Expect = 9e-06 Identities = 24/39 (61%), Positives = 30/39 (76%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNSXXXXXXQLNTVAVKIRMDCEGC 479 MGV GTLEYLS+ LS++ Q+ TV++KIRMDCEGC Sbjct: 1 MGVEGTLEYLSDLLSSAKRKKKKQIQTVSLKIRMDCEGC 39 >gb|PNX98131.1| heavy metal-associated isoprenylated plant protein 26-like [Trifolium pratense] Length = 149 Score = 53.1 bits (126), Expect = 9e-06 Identities = 25/39 (64%), Positives = 29/39 (74%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNSXXXXXXQLNTVAVKIRMDCEGC 479 MGV GTLEYLS+ LS++ Q TVA+KIRMDCEGC Sbjct: 1 MGVQGTLEYLSDLLSSTKKKKKKQTQTVALKIRMDCEGC 39 >ref|XP_006354022.1| PREDICTED: heavy metal-associated isoprenylated plant protein 26-like [Solanum tuberosum] Length = 150 Score = 53.1 bits (126), Expect = 9e-06 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 363 MGVSGTLEYLSEKLSNS-XXXXXXQLNTVAVKIRMDCEGC 479 MGVSGTLEYLSE LSN+ Q+ TV++KIRMDCEGC Sbjct: 1 MGVSGTLEYLSEVLSNAKKSKKKKQIATVSIKIRMDCEGC 40