BLASTX nr result
ID: Rehmannia31_contig00020320
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020320 (460 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011070051.1| protein ROOT PRIMORDIUM DEFECTIVE 1 [Sesamum... 55 7e-06 >ref|XP_011070051.1| protein ROOT PRIMORDIUM DEFECTIVE 1 [Sesamum indicum] Length = 431 Score = 55.1 bits (131), Expect = 7e-06 Identities = 25/35 (71%), Positives = 27/35 (77%) Frame = +1 Query: 10 ANSENGVAIKDGDFVIPILESYSGNNHGCNVKKGG 114 AN E+G KDGDFVIPILESYSGNNHGC+ G Sbjct: 397 ANDEDGGGRKDGDFVIPILESYSGNNHGCDFNYQG 431