BLASTX nr result
ID: Rehmannia31_contig00020187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020187 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHU15127.1| Nuclear poly(A) polymerase 4 [Capsicum chinense] 59 3e-07 ref|XP_017186418.1| PREDICTED: nuclear poly(A) polymerase 4-like... 59 4e-07 ref|XP_018498976.1| PREDICTED: nuclear poly(A) polymerase 4-like... 59 4e-07 ref|XP_017186417.1| PREDICTED: nuclear poly(A) polymerase 4-like... 59 4e-07 ref|XP_009347220.1| PREDICTED: nuclear poly(A) polymerase 4-like... 59 4e-07 ref|XP_009347218.1| PREDICTED: nuclear poly(A) polymerase 4-like... 59 4e-07 ref|XP_018498974.1| PREDICTED: nuclear poly(A) polymerase 4-like... 59 4e-07 ref|XP_008366646.1| PREDICTED: nuclear poly(A) polymerase 4-like... 59 4e-07 ref|XP_020547467.1| nuclear poly(A) polymerase 4-like isoform X5... 59 4e-07 ref|XP_020547463.1| nuclear poly(A) polymerase 4-like isoform X4... 59 4e-07 ref|XP_011080401.1| nuclear poly(A) polymerase 4-like isoform X3... 59 4e-07 gb|PIN26047.1| Poly(A) polymerase [Handroanthus impetiginosus] 59 4e-07 ref|XP_020547453.1| nuclear poly(A) polymerase 4-like isoform X2... 59 4e-07 ref|XP_011080393.1| nuclear poly(A) polymerase 4-like isoform X1... 59 4e-07 emb|CDO97968.1| unnamed protein product [Coffea canephora] 59 4e-07 ref|XP_020987829.1| nuclear poly(A) polymerase 4 isoform X2 [Ara... 58 5e-07 ref|XP_020968043.1| nuclear poly(A) polymerase 4 isoform X2 [Ara... 58 5e-07 gb|ONI15730.1| hypothetical protein PRUPE_3G057700 [Prunus persi... 58 5e-07 ref|XP_020414754.1| nuclear poly(A) polymerase 4 isoform X2 [Pru... 58 5e-07 ref|XP_015938371.1| nuclear poly(A) polymerase 4 isoform X1 [Ara... 58 5e-07 >gb|PHU15127.1| Nuclear poly(A) polymerase 4 [Capsicum chinense] Length = 744 Score = 58.9 bits (141), Expect = 3e-07 Identities = 29/42 (69%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV-YISLDIKTD*IG 125 VDI+AAD DDL VW+GWVESRLRQLTLM+ +SL I+ D G Sbjct: 370 VDIVAADADDLLVWRGWVESRLRQLTLMILVVSLQIERDTFG 411 >ref|XP_017186418.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X3 [Malus domestica] Length = 668 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 379 VDIIAADVDDLRAWKGWVESRLRQLTLMI 407 >ref|XP_018498976.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X2 [Pyrus x bretschneideri] Length = 675 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 379 VDIIAADVDDLRAWKGWVESRLRQLTLMI 407 >ref|XP_017186417.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X2 [Malus domestica] Length = 675 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 379 VDIIAADVDDLRAWKGWVESRLRQLTLMI 407 >ref|XP_009347220.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X2 [Pyrus x bretschneideri] ref|XP_009347226.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X2 [Pyrus x bretschneideri] Length = 675 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 379 VDIIAADVDDLRAWKGWVESRLRQLTLMI 407 >ref|XP_009347218.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Pyrus x bretschneideri] ref|XP_009347219.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Pyrus x bretschneideri] ref|XP_009347224.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Pyrus x bretschneideri] ref|XP_009347225.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Pyrus x bretschneideri] Length = 690 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 379 VDIIAADVDDLRAWKGWVESRLRQLTLMI 407 >ref|XP_018498974.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Pyrus x bretschneideri] ref|XP_018498975.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Pyrus x bretschneideri] Length = 690 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 379 VDIIAADVDDLRAWKGWVESRLRQLTLMI 407 >ref|XP_008366646.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Malus domestica] ref|XP_008366647.1| PREDICTED: nuclear poly(A) polymerase 4-like isoform X1 [Malus domestica] Length = 690 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 379 VDIIAADVDDLRAWKGWVESRLRQLTLMI 407 >ref|XP_020547467.1| nuclear poly(A) polymerase 4-like isoform X5 [Sesamum indicum] Length = 706 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAADLDDLR W+GWVESRLRQLTLM+ Sbjct: 385 VDIIAADLDDLRAWRGWVESRLRQLTLMI 413 >ref|XP_020547463.1| nuclear poly(A) polymerase 4-like isoform X4 [Sesamum indicum] Length = 708 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAADLDDLR W+GWVESRLRQLTLM+ Sbjct: 385 VDIIAADLDDLRAWRGWVESRLRQLTLMI 413 >ref|XP_011080401.1| nuclear poly(A) polymerase 4-like isoform X3 [Sesamum indicum] Length = 709 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAADLDDLR W+GWVESRLRQLTLM+ Sbjct: 385 VDIIAADLDDLRAWRGWVESRLRQLTLMI 413 >gb|PIN26047.1| Poly(A) polymerase [Handroanthus impetiginosus] Length = 744 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAADLDDLR W+GWVESRLRQLTLM+ Sbjct: 385 VDIIAADLDDLRAWRGWVESRLRQLTLMI 413 >ref|XP_020547453.1| nuclear poly(A) polymerase 4-like isoform X2 [Sesamum indicum] Length = 747 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAADLDDLR W+GWVESRLRQLTLM+ Sbjct: 385 VDIIAADLDDLRAWRGWVESRLRQLTLMI 413 >ref|XP_011080393.1| nuclear poly(A) polymerase 4-like isoform X1 [Sesamum indicum] Length = 748 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAADLDDLR W+GWVESRLRQLTLM+ Sbjct: 385 VDIIAADLDDLRAWRGWVESRLRQLTLMI 413 >emb|CDO97968.1| unnamed protein product [Coffea canephora] Length = 767 Score = 58.5 bits (140), Expect = 4e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDIIAAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 385 VDIIAADVDDLRAWKGWVESRLRQLTLMI 413 >ref|XP_020987829.1| nuclear poly(A) polymerase 4 isoform X2 [Arachis duranensis] Length = 610 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDI+AAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 286 VDIVAADVDDLRAWKGWVESRLRQLTLMI 314 >ref|XP_020968043.1| nuclear poly(A) polymerase 4 isoform X2 [Arachis ipaensis] Length = 611 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDI+AAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 286 VDIVAADVDDLRAWKGWVESRLRQLTLMI 314 >gb|ONI15730.1| hypothetical protein PRUPE_3G057700 [Prunus persica] gb|ONI15731.1| hypothetical protein PRUPE_3G057700 [Prunus persica] Length = 648 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDI+AAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 313 VDIVAADVDDLRAWKGWVESRLRQLTLMI 341 >ref|XP_020414754.1| nuclear poly(A) polymerase 4 isoform X2 [Prunus persica] Length = 649 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDI+AAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 313 VDIVAADVDDLRAWKGWVESRLRQLTLMI 341 >ref|XP_015938371.1| nuclear poly(A) polymerase 4 isoform X1 [Arachis duranensis] Length = 696 Score = 58.2 bits (139), Expect = 5e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 3 VDIIAADLDDLRVWKGWVESRLRQLTLMV 89 VDI+AAD+DDLR WKGWVESRLRQLTLM+ Sbjct: 372 VDIVAADVDDLRAWKGWVESRLRQLTLMI 400