BLASTX nr result
ID: Rehmannia31_contig00020122
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00020122 (367 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090028.1| calcium-dependent protein kinase 8 [Sesamum ... 165 5e-46 gb|PIN03795.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 164 7e-46 emb|CDP20654.1| unnamed protein product [Coffea canephora] 164 7e-46 ref|XP_012844662.1| PREDICTED: calcium-dependent protein kinase ... 164 1e-45 gb|PPE00416.1| hypothetical protein GOBAR_DD02557 [Gossypium bar... 151 3e-45 gb|AFK48659.1| unknown [Medicago truncatula] 148 4e-44 gb|PIN05937.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand... 159 5e-44 gb|OIT22318.1| calcium-dependent protein kinase 8 [Nicotiana att... 158 8e-44 dbj|BAD94111.1| calcium-dependent protein kinase, partial [Arabi... 147 1e-43 gb|PON59067.1| Phosphorylase kinase, gamma catalytic subunit [Pa... 158 1e-43 ref|XP_019237573.1| PREDICTED: calcium-dependent protein kinase ... 158 1e-43 ref|XP_023916044.1| calcium-dependent protein kinase 8-like [Que... 158 1e-43 ref|XP_016462311.1| PREDICTED: calcium-dependent protein kinase ... 158 2e-43 ref|XP_009603083.1| PREDICTED: calcium-dependent protein kinase ... 158 2e-43 ref|XP_024025214.1| calcium-dependent protein kinase 8 [Morus no... 158 2e-43 gb|PON89159.1| GPCR kinase [Trema orientalis] 157 3e-43 gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var.... 157 3e-43 gb|OVA10249.1| Protein kinase domain [Macleaya cordata] 157 4e-43 ref|XP_018848034.1| PREDICTED: calcium-dependent protein kinase ... 157 6e-43 ref|XP_016479757.1| PREDICTED: calcium-dependent protein kinase ... 156 8e-43 >ref|XP_011090028.1| calcium-dependent protein kinase 8 [Sesamum indicum] ref|XP_020552427.1| calcium-dependent protein kinase 8 [Sesamum indicum] Length = 533 Score = 165 bits (417), Expect = 5e-46 Identities = 82/88 (93%), Positives = 85/88 (96%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 ESGYIE+EELR ALSDE DANNEEVI+AIMHDVDTDKDGRISYEEFA MMKAGTDWRKAS Sbjct: 446 ESGYIEMEELRAALSDEEDANNEEVIIAIMHDVDTDKDGRISYEEFATMMKAGTDWRKAS 505 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMRDGSL+LANEGR Sbjct: 506 RQYSRERFNSLSLKLMRDGSLKLANEGR 533 >gb|PIN03795.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 531 Score = 164 bits (416), Expect = 7e-46 Identities = 83/88 (94%), Positives = 85/88 (96%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 ESGYIEIEELRDALSDE DAN+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 444 ESGYIEIEELRDALSDEEDANSEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 503 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMR+GSL LANEGR Sbjct: 504 RQYSRERFNSLSLKLMREGSLHLANEGR 531 >emb|CDP20654.1| unnamed protein product [Coffea canephora] Length = 532 Score = 164 bits (416), Expect = 7e-46 Identities = 81/88 (92%), Positives = 84/88 (95%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEI+ELRDALSDEGD N E+VI AIMHDVD DKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 445 QSGYIEIDELRDALSDEGDTNTEDVIAAIMHDVDIDKDGRISYEEFAAMMKAGTDWRKAS 504 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMRDGSLQLANEGR Sbjct: 505 RQYSRERFNSLSLKLMRDGSLQLANEGR 532 >ref|XP_012844662.1| PREDICTED: calcium-dependent protein kinase 8-like [Erythranthe guttata] gb|EYU31372.1| hypothetical protein MIMGU_mgv1a004319mg [Erythranthe guttata] Length = 533 Score = 164 bits (414), Expect = 1e-45 Identities = 80/88 (90%), Positives = 86/88 (97%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 ESGYIEI+ELRDALSDE DAN+EEVI+AIMHDVDTDKDGRISYEEFA+MMKAGTDWRKAS Sbjct: 446 ESGYIEIDELRDALSDEDDANSEEVIIAIMHDVDTDKDGRISYEEFASMMKAGTDWRKAS 505 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLM++GSL LANEGR Sbjct: 506 RQYSRERFNSLSLKLMKEGSLHLANEGR 533 >gb|PPE00416.1| hypothetical protein GOBAR_DD02557 [Gossypium barbadense] Length = 105 Score = 151 bits (382), Expect = 3e-45 Identities = 74/88 (84%), Positives = 82/88 (93%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELRDAL+DE + N+EEVI AIMHDVDTDKDGRISY+EFA MMKAGTDWRKAS Sbjct: 18 QSGYIEIEELRDALTDEVETNSEEVISAIMHDVDTDKDGRISYDEFAVMMKAGTDWRKAS 77 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFN+LSLKLM+DGSLQ+ NE R Sbjct: 78 RQYSRERFNNLSLKLMKDGSLQMNNEPR 105 >gb|AFK48659.1| unknown [Medicago truncatula] Length = 104 Score = 148 bits (374), Expect = 4e-44 Identities = 73/86 (84%), Positives = 81/86 (94%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 ++GYIEIEELR+ALSDE + N+EEVI AIMHDVDTDKDG+ISYEEFA MMKAGTDWRKAS Sbjct: 18 QTGYIEIEELRNALSDEVETNSEEVISAIMHDVDTDKDGKISYEEFANMMKAGTDWRKAS 77 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANE 258 RQYSRERFNSLSLKLM+DGSLQL N+ Sbjct: 78 RQYSRERFNSLSLKLMKDGSLQLNND 103 >gb|PIN05937.1| Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Handroanthus impetiginosus] Length = 532 Score = 159 bits (403), Expect = 5e-44 Identities = 79/88 (89%), Positives = 83/88 (94%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIE EELRDALSD+ DANNEEVI AIMHDVDTDKDGRISYEEFA MMKAGTDWRKAS Sbjct: 445 KSGYIEKEELRDALSDDDDANNEEVITAIMHDVDTDKDGRISYEEFATMMKAGTDWRKAS 504 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLS++LMRDGSLQLAN GR Sbjct: 505 RQYSRERFNSLSMELMRDGSLQLANVGR 532 >gb|OIT22318.1| calcium-dependent protein kinase 8 [Nicotiana attenuata] Length = 489 Score = 158 bits (400), Expect = 8e-44 Identities = 79/88 (89%), Positives = 82/88 (93%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELR ALSDE D N+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 402 QSGYIEIEELRSALSDEDDGNSEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 461 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMRDGSLQL NE + Sbjct: 462 RQYSRERFNSLSLKLMRDGSLQLGNEAK 489 >dbj|BAD94111.1| calcium-dependent protein kinase, partial [Arabidopsis thaliana] Length = 97 Score = 147 bits (371), Expect = 1e-43 Identities = 73/86 (84%), Positives = 79/86 (91%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +S YIEIEELR+AL+DE D N+EEV+ AIM DVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 11 QSDYIEIEELREALNDEVDTNSEEVVAAIMQDVDTDKDGRISYEEFAAMMKAGTDWRKAS 70 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANE 258 RQYSRERFNSLSLKLMR+GSLQL E Sbjct: 71 RQYSRERFNSLSLKLMREGSLQLEGE 96 >gb|PON59067.1| Phosphorylase kinase, gamma catalytic subunit [Parasponia andersonii] Length = 488 Score = 158 bits (399), Expect = 1e-43 Identities = 77/87 (88%), Positives = 84/87 (96%) Frame = +1 Query: 4 SGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR 183 SGYIEIEELR+AL+DE D N+EEVI+AIMHDVDTDKDGRISYEEF AMMKAGTDWRKASR Sbjct: 402 SGYIEIEELRNALNDEVDTNSEEVIIAIMHDVDTDKDGRISYEEFVAMMKAGTDWRKASR 461 Query: 184 QYSRERFNSLSLKLMRDGSLQLANEGR 264 QYSRERFNSLSLKLMR+GSLQLAN+G+ Sbjct: 462 QYSRERFNSLSLKLMREGSLQLANDGK 488 >ref|XP_019237573.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana attenuata] Length = 532 Score = 158 bits (400), Expect = 1e-43 Identities = 79/88 (89%), Positives = 82/88 (93%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELR ALSDE D N+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 445 QSGYIEIEELRSALSDEDDGNSEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 504 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMRDGSLQL NE + Sbjct: 505 RQYSRERFNSLSLKLMRDGSLQLGNEAK 532 >ref|XP_023916044.1| calcium-dependent protein kinase 8-like [Quercus suber] ref|XP_023916045.1| calcium-dependent protein kinase 8-like [Quercus suber] gb|POF06050.1| calcium-dependent protein kinase 8 [Quercus suber] Length = 533 Score = 158 bits (400), Expect = 1e-43 Identities = 79/88 (89%), Positives = 82/88 (93%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +S YIEIEELRDALSDE D N+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 446 QSNYIEIEELRDALSDESDTNSEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 505 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFN+LSLKLMRDGSLQ NEGR Sbjct: 506 RQYSRERFNNLSLKLMRDGSLQQPNEGR 533 >ref|XP_016462311.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana tabacum] ref|XP_016462312.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana tabacum] Length = 535 Score = 158 bits (400), Expect = 2e-43 Identities = 79/88 (89%), Positives = 82/88 (93%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELR ALSDE D N+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 448 QSGYIEIEELRSALSDEDDGNSEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 507 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMRDGSLQL NE + Sbjct: 508 RQYSRERFNSLSLKLMRDGSLQLGNEAK 535 >ref|XP_009603083.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana tomentosiformis] ref|XP_018626972.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana tomentosiformis] Length = 535 Score = 158 bits (400), Expect = 2e-43 Identities = 79/88 (89%), Positives = 82/88 (93%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELR ALSDE D N+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 448 QSGYIEIEELRSALSDEDDGNSEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 507 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMRDGSLQL NE + Sbjct: 508 RQYSRERFNSLSLKLMRDGSLQLGNEAK 535 >ref|XP_024025214.1| calcium-dependent protein kinase 8 [Morus notabilis] Length = 532 Score = 158 bits (399), Expect = 2e-43 Identities = 78/87 (89%), Positives = 84/87 (96%) Frame = +1 Query: 4 SGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR 183 SGYIEIEELR+AL+DE D+++EEV+ AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR Sbjct: 446 SGYIEIEELRNALNDEVDSSSEEVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR 505 Query: 184 QYSRERFNSLSLKLMRDGSLQLANEGR 264 QYSRERFNSLSLKLMRDGSLQL NEGR Sbjct: 506 QYSRERFNSLSLKLMRDGSLQLTNEGR 532 >gb|PON89159.1| GPCR kinase [Trema orientalis] Length = 532 Score = 157 bits (398), Expect = 3e-43 Identities = 78/87 (89%), Positives = 84/87 (96%) Frame = +1 Query: 4 SGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR 183 SGYIEIEELR+AL+DE D N+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR Sbjct: 446 SGYIEIEELRNALNDEVDTNSEEVISAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR 505 Query: 184 QYSRERFNSLSLKLMRDGSLQLANEGR 264 QYSRERFNSLSLKLMR+GSLQLAN+G+ Sbjct: 506 QYSRERFNSLSLKLMREGSLQLANDGK 532 >gb|AEY55359.1| calcium-dependent protein kinase [Morus alba var. multicaulis] Length = 532 Score = 157 bits (398), Expect = 3e-43 Identities = 78/87 (89%), Positives = 83/87 (95%) Frame = +1 Query: 4 SGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR 183 SGYIEIEELR+AL+DE D ++EEV+ AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR Sbjct: 446 SGYIEIEELRNALNDEVDTSSEEVVSAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKASR 505 Query: 184 QYSRERFNSLSLKLMRDGSLQLANEGR 264 QYSRERFNSLSLKLMRDGSLQL NEGR Sbjct: 506 QYSRERFNSLSLKLMRDGSLQLTNEGR 532 >gb|OVA10249.1| Protein kinase domain [Macleaya cordata] Length = 514 Score = 157 bits (396), Expect = 4e-43 Identities = 79/88 (89%), Positives = 83/88 (94%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELR+AL+DE D NNEEVI AIM DVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 405 QSGYIEIEELREALADELDPNNEEVINAIMRDVDTDKDGRISYEEFAAMMKAGTDWRKAS 464 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLM+DGSLQL NEGR Sbjct: 465 RQYSRERFNSLSLKLMKDGSLQLNNEGR 492 >ref|XP_018848034.1| PREDICTED: calcium-dependent protein kinase 8-like [Juglans regia] ref|XP_018848035.1| PREDICTED: calcium-dependent protein kinase 8-like [Juglans regia] Length = 533 Score = 157 bits (396), Expect = 6e-43 Identities = 79/88 (89%), Positives = 83/88 (94%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELRDALSDE D N+EEVI AIM DVDTDKDGRISYEEF+ MMKAGTDWRKAS Sbjct: 446 QSGYIEIEELRDALSDELDDNSEEVINAIMQDVDTDKDGRISYEEFSTMMKAGTDWRKAS 505 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFN+LSLKLMRDGSLQLANEGR Sbjct: 506 RQYSRERFNNLSLKLMRDGSLQLANEGR 533 >ref|XP_016479757.1| PREDICTED: calcium-dependent protein kinase 8-like [Nicotiana tabacum] Length = 534 Score = 156 bits (395), Expect = 8e-43 Identities = 78/88 (88%), Positives = 82/88 (93%) Frame = +1 Query: 1 ESGYIEIEELRDALSDEGDANNEEVIVAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 180 +SGYIEIEELR ALSDE D N+EEVI AIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS Sbjct: 447 QSGYIEIEELRSALSDEDDGNSEEVINAIMHDVDTDKDGRISYEEFAAMMKAGTDWRKAS 506 Query: 181 RQYSRERFNSLSLKLMRDGSLQLANEGR 264 RQYSRERFNSLSLKLMRDGSLQL +E + Sbjct: 507 RQYSRERFNSLSLKLMRDGSLQLGSEAK 534