BLASTX nr result
ID: Rehmannia31_contig00019957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00019957 (1255 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019190884.1| PREDICTED: uncharacterized protein LOC109185... 57 3e-06 >ref|XP_019190884.1| PREDICTED: uncharacterized protein LOC109185354 [Ipomoea nil] Length = 137 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/59 (44%), Positives = 41/59 (69%) Frame = +3 Query: 201 DEIPEEICSILEKKILFKVQIKSEQLRNYTGAFAVVKLTDDPALISKYGCSVFESQVNR 377 D+IP EI + + +LFKV +K EQL+N+ AF V+K+ DPA++S Y CS+ E + ++ Sbjct: 9 DDIPREIEGLCGRILLFKVSVKKEQLKNFNSAFPVIKVVTDPAMLSTY-CSMLELEQDK 66