BLASTX nr result
ID: Rehmannia31_contig00019745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00019745 (454 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083687.1| DUF21 domain-containing protein At1g47330 [S... 63 1e-08 >ref|XP_011083687.1| DUF21 domain-containing protein At1g47330 [Sesamum indicum] Length = 453 Score = 62.8 bits (151), Expect = 1e-08 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = +2 Query: 2 YVNIHNRIKINMNASHDKATESNSIQSLPPASS-PLRPVVSST 127 YVNIHNRIKINMNAS DKA + NSIQ+LPP S+ PL+ V SST Sbjct: 409 YVNIHNRIKINMNASQDKAPQLNSIQALPPTSAPPLQSVASST 451