BLASTX nr result
ID: Rehmannia31_contig00019628
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00019628 (352 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22317.1| Transcription initiation factor TFIID, subunit TA... 60 6e-08 >gb|PIN22317.1| Transcription initiation factor TFIID, subunit TAF12 [Handroanthus impetiginosus] Length = 694 Score = 59.7 bits (143), Expect = 6e-08 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 331 NSGIYGQMNFGGMNTMQQSPQQQNSNVGINNT 236 NSGIYGQMNFGGMN +QQ P QQNSNV +NNT Sbjct: 155 NSGIYGQMNFGGMNAIQQQPPQQNSNVNMNNT 186