BLASTX nr result
ID: Rehmannia31_contig00019283
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00019283 (570 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18306.1| hypothetical protein CDL12_09010 [Handroanthus im... 77 2e-15 ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane d... 76 5e-15 ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane d... 74 4e-14 ref|XP_022744616.1| cysteine-rich and transmembrane domain-conta... 72 3e-13 gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] 71 4e-13 gb|OMO60111.1| hypothetical protein COLO4_33936 [Corchorus olito... 71 4e-13 gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus cl... 70 8e-13 gb|PIM97369.1| hypothetical protein CDL12_30160 [Handroanthus im... 70 9e-13 ref|XP_007028562.2| PREDICTED: cysteine-rich and transmembrane d... 70 1e-12 gb|ONH95012.1| hypothetical protein PRUPE_7G046400 [Prunus persica] 70 1e-12 ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane d... 69 2e-12 gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium r... 68 4e-12 ref|XP_017610545.1| PREDICTED: cysteine-rich and transmembrane d... 68 6e-12 emb|CBI30080.3| unnamed protein product, partial [Vitis vinifera] 67 8e-12 gb|PRQ49708.1| putative cysteine-rich transmembrane CYSTM domain... 67 8e-12 ref|XP_023636001.1| cysteine-rich and transmembrane domain-conta... 67 9e-12 gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] 67 1e-11 ref|XP_019090509.1| PREDICTED: cysteine-rich and transmembrane d... 67 1e-11 ref|NP_196028.2| cysteine-rich TM module stress tolerance protei... 67 1e-11 ref|XP_002871075.1| cysteine-rich and transmembrane domain-conta... 67 1e-11 >gb|PIN18306.1| hypothetical protein CDL12_09010 [Handroanthus impetiginosus] Length = 58 Score = 77.0 bits (188), Expect = 2e-15 Identities = 32/36 (88%), Positives = 33/36 (91%) Frame = +3 Query: 228 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCFD 335 KK K PRTKAKG+RGFLEGCLFALCCCWLCEVCFD Sbjct: 23 KKMKCWPRTKAKGERGFLEGCLFALCCCWLCEVCFD 58 >ref|XP_015165117.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Solanum tuberosum] Length = 62 Score = 75.9 bits (185), Expect = 5e-15 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 228 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCFD 335 KK KG PR+K +G+RGFLEGCLFALCCCWLCEVCFD Sbjct: 27 KKMKGWPRSKPRGERGFLEGCLFALCCCWLCEVCFD 62 >ref|XP_009764368.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Nicotiana sylvestris] Length = 62 Score = 73.6 bits (179), Expect = 4e-14 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +3 Query: 228 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCFD 335 KK K PR+K KG+RGFLEGCLFALCCCW+CEVCFD Sbjct: 27 KKMKCFPRSKPKGERGFLEGCLFALCCCWICEVCFD 62 >ref|XP_022744616.1| cysteine-rich and transmembrane domain-containing protein WIH2 [Durio zibethinus] Length = 77 Score = 71.6 bits (174), Expect = 3e-13 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 +KK PRTK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 44 QKKCFPRTKKKGDRGFIEGCLFALCCCWLCETCF 77 >gb|EEF30889.1| conserved hypothetical protein [Ricinus communis] Length = 56 Score = 70.9 bits (172), Expect = 4e-13 Identities = 28/34 (82%), Positives = 29/34 (85%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 KKK P TK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 23 KKKCCPNTKKKGDRGFIEGCLFALCCCWLCEACF 56 >gb|OMO60111.1| hypothetical protein COLO4_33936 [Corchorus olitorius] Length = 58 Score = 70.9 bits (172), Expect = 4e-13 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 +KK PRTK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 25 QKKCSPRTKKKGDRGFIEGCLFALCCCWLCEACF 58 >gb|ESR34507.1| hypothetical protein CICLE_v10006402mg [Citrus clementina] Length = 60 Score = 70.1 bits (170), Expect = 8e-13 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 KKK L +TK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 27 KKKCLSQTKKKGDRGFIEGCLFALCCCWLCEACF 60 >gb|PIM97369.1| hypothetical protein CDL12_30160 [Handroanthus impetiginosus] Length = 52 Score = 69.7 bits (169), Expect = 9e-13 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +3 Query: 228 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 K KK PR+K KGDRGF+EGCLFALCCCW+C++CF Sbjct: 18 KMKKCWPRSKPKGDRGFIEGCLFALCCCWICDICF 52 >ref|XP_007028562.2| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Theobroma cacao] Length = 56 Score = 69.7 bits (169), Expect = 1e-12 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 +KK RTK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 23 QKKSFSRTKKKGDRGFIEGCLFALCCCWLCETCF 56 >gb|ONH95012.1| hypothetical protein PRUPE_7G046400 [Prunus persica] Length = 58 Score = 69.7 bits (169), Expect = 1e-12 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = +3 Query: 234 KKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 KK PRTK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 26 KKFRPRTKKKGDRGFIEGCLFALCCCWLCEECF 58 >ref|XP_011467336.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Fragaria vesca subsp. vesca] Length = 59 Score = 68.9 bits (167), Expect = 2e-12 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 +KK P+TK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 26 RKKFRPQTKKKGDRGFIEGCLFALCCCWLCEECF 59 >gb|KJB35914.1| hypothetical protein B456_006G133500 [Gossypium raimondii] Length = 60 Score = 68.2 bits (165), Expect = 4e-12 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 + K PR+K KGDRGF+EGCLFALCCCWLCE CF Sbjct: 27 QNKCFPRSKKKGDRGFIEGCLFALCCCWLCETCF 60 >ref|XP_017610545.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein A [Gossypium arboreum] Length = 76 Score = 68.2 bits (165), Expect = 6e-12 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 + K PR+K KGDRGF+EGCLFALCCCWLCE CF Sbjct: 43 QNKCFPRSKKKGDRGFIEGCLFALCCCWLCETCF 76 >emb|CBI30080.3| unnamed protein product, partial [Vitis vinifera] Length = 56 Score = 67.4 bits (163), Expect = 8e-12 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 234 KKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 K PR+K+KGDRGF+EGCLFALCCCW+CE CF Sbjct: 24 KNCCPRSKSKGDRGFIEGCLFALCCCWICEACF 56 >gb|PRQ49708.1| putative cysteine-rich transmembrane CYSTM domain-containing protein [Rosa chinensis] Length = 59 Score = 67.4 bits (163), Expect = 8e-12 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 231 KKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 +KK RTK KGDRGF+EGCLFALCCCWLCE CF Sbjct: 26 RKKFRSRTKKKGDRGFIEGCLFALCCCWLCEECF 59 >ref|XP_023636001.1| cysteine-rich and transmembrane domain-containing protein WIH1 isoform X1 [Capsella rubella] Length = 63 Score = 67.4 bits (163), Expect = 9e-12 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +3 Query: 231 KKKGLPR---TKAKGDRGFLEGCLFALCCCWLCEVCF 332 KKK PR TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 27 KKKNNPRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >gb|KFK24859.1| hypothetical protein AALP_AA8G034200 [Arabis alpina] Length = 67 Score = 67.4 bits (163), Expect = 1e-11 Identities = 28/38 (73%), Positives = 32/38 (84%), Gaps = 3/38 (7%) Frame = +3 Query: 228 KKKKGLPR---TKAKGDRGFLEGCLFALCCCWLCEVCF 332 +KKK PR TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 30 EKKKKKPRFFETKEKGDRGFIEGCLFALCCCWICEMCF 67 >ref|XP_019090509.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein B [Camelina sativa] ref|XP_019084530.1| PREDICTED: cysteine-rich and transmembrane domain-containing protein B-like [Camelina sativa] Length = 63 Score = 67.0 bits (162), Expect = 1e-11 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 228 KKKKGLPRTKAKGDRGFLEGCLFALCCCWLCEVCF 332 KKK TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 29 KKKSRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >ref|NP_196028.2| cysteine-rich TM module stress tolerance protein [Arabidopsis thaliana] gb|AAR24695.1| At5g04080 [Arabidopsis thaliana] gb|AAS00338.1| At5g04080 [Arabidopsis thaliana] gb|AED90694.1| cysteine-rich TM module stress tolerance protein [Arabidopsis thaliana] gb|OAO95527.1| hypothetical protein AXX17_AT5G03460 [Arabidopsis thaliana] Length = 63 Score = 67.0 bits (162), Expect = 1e-11 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +3 Query: 231 KKKGLPR---TKAKGDRGFLEGCLFALCCCWLCEVCF 332 KKK PR TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 27 KKKKKPRFFETKQKGDRGFIEGCLFALCCCWICEMCF 63 >ref|XP_002871075.1| cysteine-rich and transmembrane domain-containing protein A isoform X1 [Arabidopsis lyrata subsp. lyrata] gb|EFH47334.1| hypothetical protein ARALYDRAFT_908293 [Arabidopsis lyrata subsp. lyrata] Length = 64 Score = 67.0 bits (162), Expect = 1e-11 Identities = 28/37 (75%), Positives = 31/37 (83%), Gaps = 3/37 (8%) Frame = +3 Query: 231 KKKGLPR---TKAKGDRGFLEGCLFALCCCWLCEVCF 332 KKK PR TK KGDRGF+EGCLFALCCCW+CE+CF Sbjct: 28 KKKKKPRFFETKKKGDRGFIEGCLFALCCCWICEMCF 64