BLASTX nr result
ID: Rehmannia31_contig00019119
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00019119 (485 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN61362.1| hypothetical protein Csa_2G099460 [Cucumis sativus] 63 1e-08 ref|XP_019246156.1| PREDICTED: putative RNA-binding protein Luc7... 56 4e-06 >gb|KGN61362.1| hypothetical protein Csa_2G099460 [Cucumis sativus] Length = 335 Score = 63.2 bits (152), Expect = 1e-08 Identities = 33/46 (71%), Positives = 35/46 (76%) Frame = +1 Query: 1 HFGGKLHLGYMQIREKLAELQVLL*CSNFF*RFSVYLSFLCEFSYP 138 HFGGKLHLGYMQIREKLAELQVLL SN Y F+CEFS+P Sbjct: 291 HFGGKLHLGYMQIREKLAELQVLLYVSNSTIEILSYY-FICEFSFP 335 >ref|XP_019246156.1| PREDICTED: putative RNA-binding protein Luc7-like 1 isoform X2 [Nicotiana attenuata] ref|XP_019246157.1| PREDICTED: putative RNA-binding protein Luc7-like 1 isoform X2 [Nicotiana attenuata] Length = 327 Score = 55.8 bits (133), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 HFGGKLHLGYMQIREKLAELQVLL*CSNFF*RFS 102 HFGGKLHLGY+QIREKLAELQVL+ C FF R S Sbjct: 291 HFGGKLHLGYIQIREKLAELQVLVYCFTFFYRDS 324