BLASTX nr result
ID: Rehmannia31_contig00019031
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00019031 (577 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020552017.1| uncharacterized protein LOC105169559 isoform... 96 4e-20 ref|XP_011088282.1| uncharacterized protein LOC105169559 isoform... 96 6e-20 ref|XP_011092579.1| uncharacterized protein LOC105172725 [Sesamu... 93 1e-18 ref|XP_012831046.1| PREDICTED: uncharacterized protein LOC105952... 92 2e-18 gb|PIN24685.1| hypothetical protein CDL12_02584 [Handroanthus im... 91 5e-18 gb|PIN15302.1| hypothetical protein CDL12_12068 [Handroanthus im... 91 7e-18 ref|XP_012836963.1| PREDICTED: uncharacterized protein LOC105957... 88 4e-17 gb|PIN06060.1| hypothetical protein CDL12_21401 [Handroanthus im... 87 7e-17 ref|XP_022897101.1| uncharacterized protein LOC111410799 isoform... 82 1e-14 gb|EPS61708.1| hypothetical protein M569_13086, partial [Genlise... 80 3e-14 ref|XP_018841953.1| PREDICTED: uncharacterized protein LOC109006... 80 5e-14 ref|XP_023912848.1| uncharacterized protein LOC112024444 [Quercu... 77 3e-13 ref|XP_021685219.1| uncharacterized protein LOC110668335 [Hevea ... 77 3e-13 gb|PON63397.1| Alpha/Beta hydrolase fold containing protein [Tre... 77 6e-13 ref|XP_021626083.1| uncharacterized protein LOC110624927 [Maniho... 77 6e-13 ref|XP_018835571.1| PREDICTED: uncharacterized protein LOC109002... 76 8e-13 ref|XP_024028956.1| uncharacterized protein LOC112093851 [Morus ... 76 8e-13 dbj|GAV70292.1| DUF829 domain-containing protein [Cephalotus fol... 76 8e-13 gb|PON69121.1| Alpha/Beta hydrolase fold containing protein [Par... 75 3e-12 ref|XP_021832678.1| uncharacterized protein LOC110772548 [Prunus... 75 3e-12 >ref|XP_020552017.1| uncharacterized protein LOC105169559 isoform X2 [Sesamum indicum] Length = 378 Score = 96.3 bits (238), Expect = 4e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWDIKFSGSLNGEPFASVR+RS FGGIKHRSRL Sbjct: 331 LGQILFDVCVPKNVEGWDIKFSGSLNGEPFASVRRRSPFGGIKHRSRL 378 >ref|XP_011088282.1| uncharacterized protein LOC105169559 isoform X1 [Sesamum indicum] Length = 405 Score = 96.3 bits (238), Expect = 6e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWDIKFSGSLNGEPFASVR+RS FGGIKHRSRL Sbjct: 358 LGQILFDVCVPKNVEGWDIKFSGSLNGEPFASVRRRSPFGGIKHRSRL 405 >ref|XP_011092579.1| uncharacterized protein LOC105172725 [Sesamum indicum] Length = 404 Score = 92.8 bits (229), Expect = 1e-18 Identities = 43/48 (89%), Positives = 45/48 (93%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWDIKFSGSLNGEPFAS+R+RS F GIKHRSRL Sbjct: 357 LGQILFDVCVPKNVEGWDIKFSGSLNGEPFASIRRRSPFTGIKHRSRL 404 >ref|XP_012831046.1| PREDICTED: uncharacterized protein LOC105952087 [Erythranthe guttata] gb|EYU42666.1| hypothetical protein MIMGU_mgv1a007838mg [Erythranthe guttata] Length = 393 Score = 91.7 bits (226), Expect = 2e-18 Identities = 43/48 (89%), Positives = 44/48 (91%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWDIKFSGSLNGEP ASVR+RS F GIKHRSRL Sbjct: 346 LGQVLFDVCVPKNVEGWDIKFSGSLNGEPVASVRRRSPFSGIKHRSRL 393 >gb|PIN24685.1| hypothetical protein CDL12_02584 [Handroanthus impetiginosus] Length = 406 Score = 90.9 bits (224), Expect = 5e-18 Identities = 43/48 (89%), Positives = 43/48 (89%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWDIKFSGSLNGEP AS RKRS F GIKHRSRL Sbjct: 359 LGQILFDVCVPKNVEGWDIKFSGSLNGEPMASFRKRSPFSGIKHRSRL 406 >gb|PIN15302.1| hypothetical protein CDL12_12068 [Handroanthus impetiginosus] Length = 406 Score = 90.5 bits (223), Expect = 7e-18 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWD+KFSGSLNGEP AS+RKRS F GIKHRSRL Sbjct: 359 LGQILFDVCVPKNVEGWDMKFSGSLNGEPMASLRKRSPFSGIKHRSRL 406 >ref|XP_012836963.1| PREDICTED: uncharacterized protein LOC105957573 [Erythranthe guttata] gb|EYU37695.1| hypothetical protein MIMGU_mgv1a008067mg [Erythranthe guttata] Length = 386 Score = 88.2 bits (217), Expect = 4e-17 Identities = 38/48 (79%), Positives = 43/48 (89%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVC+PKN+EGWDIKFSGSLNGEPF S+R+RS F G+K RSRL Sbjct: 339 LGQALFDVCIPKNIEGWDIKFSGSLNGEPFGSIRRRSTFSGMKQRSRL 386 >gb|PIN06060.1| hypothetical protein CDL12_21401 [Handroanthus impetiginosus] Length = 305 Score = 86.7 bits (213), Expect = 7e-17 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWDIKFSG LNGEPFASV +RS F G KH+SRL Sbjct: 258 LGQILFDVCVPKNVEGWDIKFSGFLNGEPFASVCRRSTFSGFKHKSRL 305 >ref|XP_022897101.1| uncharacterized protein LOC111410799 isoform X1 [Olea europaea var. sylvestris] Length = 412 Score = 81.6 bits (200), Expect = 1e-14 Identities = 38/48 (79%), Positives = 40/48 (83%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKNVEGWDIKF+GSLN +P ASVRKR F KHRSRL Sbjct: 365 LGQVLFDVCVPKNVEGWDIKFAGSLNAKPLASVRKRLPFNATKHRSRL 412 >gb|EPS61708.1| hypothetical protein M569_13086, partial [Genlisea aurea] Length = 314 Score = 79.7 bits (195), Expect = 3e-14 Identities = 36/48 (75%), Positives = 41/48 (85%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKHRSRL 146 LGQ LFDVCVPKN+EGWDIKF+GS+NG+P SVRKRS F +K RSRL Sbjct: 267 LGQVLFDVCVPKNIEGWDIKFTGSVNGDPHPSVRKRSPFWTVKRRSRL 314 >ref|XP_018841953.1| PREDICTED: uncharacterized protein LOC109006952 [Juglans regia] Length = 409 Score = 79.7 bits (195), Expect = 5e-14 Identities = 40/50 (80%), Positives = 42/50 (84%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LGQ LFDVCVPKNVEGWDIKF GSLNG+PFASVR+ S F GIK RSRL Sbjct: 360 LGQILFDVCVPKNVEGWDIKFGGSLNGQPFASVRRPSPFQGIKCIRRSRL 409 >ref|XP_023912848.1| uncharacterized protein LOC112024444 [Quercus suber] gb|POF09991.1| hypothetical protein CFP56_39940 [Quercus suber] Length = 414 Score = 77.4 bits (189), Expect = 3e-13 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LGQ LFDVCVPKNVEGWDIKF G++NG+PFAS R+ S F GIK RSRL Sbjct: 365 LGQILFDVCVPKNVEGWDIKFGGTVNGQPFASARRHSPFNGIKCNRRSRL 414 >ref|XP_021685219.1| uncharacterized protein LOC110668335 [Hevea brasiliensis] Length = 418 Score = 77.4 bits (189), Expect = 3e-13 Identities = 38/50 (76%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LGQ LFDVCVPKNVEGWDI+FSGSLNG+P AS R+ SL GIK RSRL Sbjct: 369 LGQMLFDVCVPKNVEGWDIRFSGSLNGQPIASARRHSLIHGIKCTRRSRL 418 >gb|PON63397.1| Alpha/Beta hydrolase fold containing protein [Trema orientalis] Length = 410 Score = 76.6 bits (187), Expect = 6e-13 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LG+ LFD CVPKNVEGWDIKF GSLNG+PFAS RK S F GIK RSRL Sbjct: 361 LGRLLFDACVPKNVEGWDIKFCGSLNGQPFASARKHSPFHGIKSIRRSRL 410 >ref|XP_021626083.1| uncharacterized protein LOC110624927 [Manihot esculenta] gb|OAY39084.1| hypothetical protein MANES_10G066100 [Manihot esculenta] Length = 419 Score = 76.6 bits (187), Expect = 6e-13 Identities = 37/50 (74%), Positives = 42/50 (84%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LGQ LFDVCVPKNVEGWDI+FSGSLNG+P AS R++SL GIK RS+L Sbjct: 370 LGQMLFDVCVPKNVEGWDIRFSGSLNGQPIASARRQSLLHGIKLPRRSKL 419 >ref|XP_018835571.1| PREDICTED: uncharacterized protein LOC109002331 [Juglans regia] Length = 409 Score = 76.3 bits (186), Expect = 8e-13 Identities = 38/50 (76%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LGQ LFDVCVPKNVEGWDIKF GSLNG+PFAS R+ S GIK RSRL Sbjct: 360 LGQFLFDVCVPKNVEGWDIKFGGSLNGQPFASARRNSPIQGIKCTRRSRL 409 >ref|XP_024028956.1| uncharacterized protein LOC112093851 [Morus notabilis] Length = 410 Score = 76.3 bits (186), Expect = 8e-13 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIKH--RSRL 146 LG+ LFD CVPKNVEGWDIKF GSLNG+PFAS R+ S F GIK+ RSRL Sbjct: 361 LGELLFDACVPKNVEGWDIKFCGSLNGQPFASARRHSPFHGIKNIRRSRL 410 >dbj|GAV70292.1| DUF829 domain-containing protein [Cephalotus follicularis] Length = 414 Score = 76.3 bits (186), Expect = 8e-13 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LGQ LFD CVPKNVEGWDI+FSGSLNG+P AS R+RS F G K RSRL Sbjct: 365 LGQVLFDACVPKNVEGWDIRFSGSLNGQPLASARRRSPFQGFKCNRRSRL 414 >gb|PON69121.1| Alpha/Beta hydrolase fold containing protein [Parasponia andersonii] Length = 408 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/50 (74%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LG+ LFD CVPKNVEGWDIKF GSLNG+PFAS RK S F G K RSRL Sbjct: 359 LGRLLFDACVPKNVEGWDIKFCGSLNGQPFASARKHSPFNGNKSIRRSRL 408 >ref|XP_021832678.1| uncharacterized protein LOC110772548 [Prunus avium] Length = 417 Score = 74.7 bits (182), Expect = 3e-12 Identities = 37/50 (74%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = +3 Query: 3 LGQTLFDVCVPKNVEGWDIKFSGSLNGEPFASVRKRSLFGGIK--HRSRL 146 LGQ LFDVCVPKNVEGWDIKF GSLNG+PFAS R+ S G+K RSRL Sbjct: 368 LGQVLFDVCVPKNVEGWDIKFGGSLNGQPFASARRNSPPHGLKSIRRSRL 417