BLASTX nr result
ID: Rehmannia31_contig00018959
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018959 (471 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022858290.1| splicing factor 3B subunit 4-like [Olea euro... 55 2e-06 >ref|XP_022858290.1| splicing factor 3B subunit 4-like [Olea europaea var. sylvestris] Length = 171 Score = 55.1 bits (131), Expect = 2e-06 Identities = 34/73 (46%), Positives = 39/73 (53%), Gaps = 2/73 (2%) Frame = +1 Query: 28 SVLRSHHGRLETAPSLHLLCQRSVHHRPRMS-TNPCRCTERL-GRVSHHNPVAFLHRKCS 201 S L HG + A LH Q SVHH R+ T PCRC + GRV+HHN V + Sbjct: 95 SALVPPHGLSQMAVFLHPRSQHSVHHLHRLVFTPPCRCPDHHPGRVNHHNLVKLAWFRQC 154 Query: 202 SSSGECRRHLLHK 240 SSG CRR LHK Sbjct: 155 RSSGACRRRHLHK 167