BLASTX nr result
ID: Rehmannia31_contig00018951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia31_contig00018951 (531 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KGN43564.1| hypothetical protein Csa_7G045530 [Cucumis sativus] 72 1e-13 >gb|KGN43564.1| hypothetical protein Csa_7G045530 [Cucumis sativus] Length = 80 Score = 72.4 bits (176), Expect = 1e-13 Identities = 42/71 (59%), Positives = 47/71 (66%) Frame = -1 Query: 297 LLHA*SDLGSCSCKSFYFSLAATTSSKVSHTSDKVWGDNESVILLCVLRRSRSSHIWRLC 118 LLH L S K F+LAA TSSK S T VW + VI L VLR+SRSSHIWRLC Sbjct: 12 LLHVCIGLVSLVVKKTPFTLAAATSSKSSRTFKWVW--DNGVISLGVLRKSRSSHIWRLC 69 Query: 117 RISEGLSVDYG 85 R+ EGLS+DYG Sbjct: 70 RVLEGLSLDYG 80